LOADING...
   ZP_02030627.1;SP0437A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02030627.1    Secondary Structure Prediction




   Transmembrane helix      alpha-helix      beta-strand    

Secondary Structure Map

>ZP_02030627.1 gi|154490366|ref|ZP_02030627.1| hypothetical protein PARMER_00599 [Parabacteroides merdae ATCC 43184]
     1 MNKNKLFASVIGLLVFVAGLSAKDYQVAMFGIKSDGVTLNTRSIQRAVDYISEQGGGRLI     60
       -----HHHHHHHEEEEEE------EEEEEEE-----EEE---HHHEEEEEEE-----EEE       
    61 FYVGRYLTGSIELKSNVTIRIEEGAVLVAVPSVYDFKGVGGCNAIIYADKQKNIGIGGKG    120
       EEE--------E----EEHHHHH-EEEEEE--EEE-------EEEEHHHHHH--------       
   121 IIDGRSIAVRASVEEQLQKGHIEGNVSDYAPALICMEGCEDVKIEQVTLQDAANVAEIYK    180
       -----HHHHHHHHHHHHHH------------HHHHH-----HHHHHHHHHHHHHHHH---       
   181 DCHNVTVDKVVVNAGASDRKAISISGCDGVKMTDCYFNMAGNPLESAGTSRNLIFTNCIT    240
       ----EEEEEEEEE------EEEEE------E--EEEE--------------EEEEEEEE-       
   241 PDGKAVSSDQ                                                      250
       ----------       

Secondary structure: H - alpha helix, E - beta strand

Notes
Secondary structure prediction is done using JNET: A Neural Network Protein Secondary Structure Prediction Method.
Contact Webmaster JCSG Menu