LOADING...
   YP_098753.1;SP13297E
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_098753.1    Secondary Structure Prediction




   Transmembrane helix      alpha-helix      beta-strand    

Secondary Structure Map

>YP_098753.1 gi|53712761|ref|YP_098753.1| hypothetical protein BF1468 [Bacteroides fragilis YCH46]
     1 MKKRVLLWMAGLVFAVTSLFAQDIPVGVVVAFKKGNSQELNRYLGEKVNLVIQNRSESVD     60
       ---HHHHHHHHHHHHHHHHH-----EEEEEEE-----HHHHHHHH--EEEEEE-----HH       
    61 RQAAEGTLAAFFSSNKVSGFNVNHEGKRDESSFIIGTLTTANGNFRINCFFRRVQNKYLI    120
       HHHHHHHHEEEE-------EE-----------EEEEEEEE----EEEHHHHHHHHHHHHH       
   121 NQIRIDKTNE                                                      130
       HHHH------       

Secondary structure: H - alpha helix, E - beta strand

Notes
Secondary structure prediction is done using JNET: A Neural Network Protein Secondary Structure Prediction Method.
Contact Webmaster JCSG Menu