LOADING...
   YP_095136.1;SP19086A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_095136.1    Secondary Structure Prediction




   Transmembrane helix      alpha-helix      beta-strand    

Secondary Structure Map

>YP_095136.1 gi|52841337|ref|YP_095136.1| hypothetical protein lpg1103 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
     1 MVMKTMRLFKGILFTFCGIIFCFNSHAALEHEKLVNYIALGEFSRETAEIALKKMPPLDT     60
       ----HHHHHH--HHHH--EEE----HHHHHHHHHHHHHH-----HHHHHHHHH-------       
    61 LTVHYDLQLYKINYKTQSPDGNLTIASGLVAMPIHPVGQVGIISYQHGTRFERNDVPSRN    120
       -HHHHHHHHHHHH----------EEEEEEEE--------EEEEEE-----E---------       
   121 NEKNYIYLAAYGNSAGYMTVMPDYLGLGDNELTLHPYVQAETLASSSIDMLFAAKELANR    180
       ----EEEEEE------EEEE-----------------HHHHH----HHHHHHHHHHHHHH       
   181 LHYPISDKLYLAGYSEGGFSTIVMFEMLAKEYPDLPVSAVAPGSAPYGWEETMHFVMLEP    240
       -------HHHHH-------EEHHHHHHHH---------E------------EEEEEE---       
   241 GPRATAYLAYFFYSLQTYKSYWSGFDEIFAPPYNTLIPELMDGYHAVDEILQALPQDPLL    300
       --HHHHHHHHHHHHHHHHH-------EE----------------HHHHHHHHH------E       
   301 IFQPKFSNGIISKTDRNTEILKINFNHYDFKPTAPLLLVGTKGDRDVPYAGAEMAYHSFR    360
       EE-------EEEE----EEEEEE------------EEEE-----------HHHHHHHHH-       
   361 KYSDFVWIKSVSDALDHVQAHPFVLKEQVDFFKQFERQEAMNK                     403
       ----EEEEEE-------------HHHHHHHHHHHHHHHH----       

Secondary structure: H - alpha helix, E - beta strand

Notes
Secondary structure prediction is done using JNET: A Neural Network Protein Secondary Structure Prediction Method.
Contact Webmaster JCSG Menu