LOADING...
   YP_001714229.1;SP2417A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001714229.1    Secondary Structure Prediction




   Transmembrane helix      alpha-helix      beta-strand    

Secondary Structure Map

>YP_001714229.1 gi|169796436|ref|YP_001714229.1| ankyrin repeat-containing protein [Acinetobacter baumannii AYE]
     1 MPNCYAIHFYLECFMRKSLIWINLIIAMGALGFTNAVNAKDEYPLHMAAANDDIQLIKHI     60
       -----HHHHHHHHHHHHHHHHHHHHHHHHHH------------HHHHHHH--HHHHHHHH       
    61 LSQKTLIDARDETGSTALMVATRANNIHAAHMLIEAGADVNAKDNIQDSPYLYAGAQGYL    120
       HHHHHH---------HHHHHHHHHHHHHHHHHHHHH--------------HHHHHHHHHH       
   121 KILRMTLMHGADLKSTNRYGGTALIPAAERGHVETVRTLIAAGVNVNHVNNLGWTALLEA    180
       HHHHHHHHH-------------EEEE------EEEEEEEEEE-----------HHHHHHH       
   181 IILGNGKSNYQQIVALLLKAGANPNLADKDGITPLQHARTRGYREIEKLLLVAGAK        236
       HHH------HHHHHHHHHH---------------HHHHH---HHHHHHHHHH----       

Secondary structure: H - alpha helix, E - beta strand

Notes
Secondary structure prediction is done using JNET: A Neural Network Protein Secondary Structure Prediction Method.
Contact Webmaster JCSG Menu