LOADING...
   YP_001305260.1;PX14343H
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001305260.1    Secondary Structure Prediction




   Transmembrane helix      alpha-helix      beta-strand    

Secondary Structure Map

>YP_001305260.1 gi|150010517|ref|YP_001305260.1| putative outer membrane protein, probably involved in nutrient binding [Parabacteroides distasonis ATCC 8503]
     1 MKINKIYIVSLCALFLSSCNNFLDEQPTGTMTTDSKLTSKESALALTNSAYLKNTVFNKM     60
       -----EEEEHHHHHH---------------E-------HHHHHHHHHHHHHHHHEEEEE-       
    61 TPGWGCNTILLLEYMTGKATSENSQSNYKDFQDLLVSDRSLYIEDWWQDCYAGIANCNLA    120
       -------EEEEEEEE---------------HHHEE-----EEE---HHHHHHHHHHHHHH       
   121 LQKLGEFENLDASLVNGYMAEVKFMRALYYFYLVRIFGDVPKITTVQSELGELQVSRAPV    180
       HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEE-----EEEEE---HHHHH-----       
   181 KEIYDEIIIPDLLEAEQSDLAFSDHTGRVSMGAVKALLADVYLTYAGYPLQGGKSYYAES    240
       HHHHHHHH---HHHHHHHHHH------HHHHHHHHHHHHHHHHHHH---------HHHHH       
   241 AKRSLEVIKSNEYTLFTDYESLRLPSQNNKGEFIYQVQFSLNKRHNESVRIFLPSRSGIS    300
       HH-EEEEE----EEEE-HHHHH---------EEEEEEEEE-------EEEEEE------E       
   301 AYDLEYGSLIPTKEFVESFEKGDKRTEEKQYFFTNYKGHPSKFSPGAAELEFMDLNGYYI    360
       -------------EEEEE-------HHHHEEEEE------------HHHHHHHH----EE       
   361 YKFFDQVAVDNTAKSDLNWSVYRYTDVLLMYAEAQVNADGTPNQQSIDIVNQIRGRAGLA    420
       EEEEEEEEEE--------EEHHHHHHHHHHHHHHHHH--------HHHHHHHHHHH----       
   421 PFKQTNASAFLEEVWDQRYFDLCYENKMWFDMLRTRKIRDDKSGEYVDFIGYKTNWGKVY    480
       ------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-------EEEEEEEE----EEE       
   481 TETQLLFPIPLSERQANPNLTQNQGY                                      506
       EEEE----------------------       

Secondary structure: H - alpha helix, E - beta strand

Notes
Secondary structure prediction is done using JNET: A Neural Network Protein Secondary Structure Prediction Method.
Contact Webmaster JCSG Menu