LOADING...
   YP_001304549.1;SP13991A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001304549.1    Secondary Structure Prediction




   Transmembrane helix      alpha-helix      beta-strand    

Secondary Structure Map

>YP_001304549.1 gi|150009806|ref|YP_001304549.1| hypothetical protein BDI_3222 [Parabacteroides distasonis ATCC 8503]
     1 MKTSVWGKSILALVFTFMCSLAISAASPKDYLYDTKEENGKIISKVVFLQENGLLNKQVR     60
       ---------EEEHHHHHHHHHHHHH------EE-------EEEEEEEEE----HHHHHHH       
    61 YEFQYNENGKVSEKKAFRWDRTNDEWVPFYQITYQYDDQSGEIKTNYGMWDKKKKNFSLN    120
       HHHH--------HHHH-E----------EEEEEEE-------EEE------------EE-       
   121 VQNMIIPSTNYEEIFS                                                136
       --EEE-----------       

Secondary structure: H - alpha helix, E - beta strand

Notes
Secondary structure prediction is done using JNET: A Neural Network Protein Secondary Structure Prediction Method.
Contact Webmaster JCSG Menu