LOADING...
   YP_001299918.1;GS13848A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001299918.1    Secondary Structure Prediction




   Transmembrane helix      alpha-helix      beta-strand    

Secondary Structure Map

>YP_001299918.1 gi|150005174|ref|YP_001299918.1| hypothetical protein BVU_2644 [Bacteroides vulgatus ATCC 8482]
     1 MNRHALLSLLALLLCCSTSLPAQKAKTYIPWKNGKLVVSEEGRYLKHENGVPFFWLGETG     60
       ---HHHHHHHHHHHHH-----------E-------EEEE-----EE-----EEEEE----       
    61 WLMPQRLNRDEVSYYLNKCKDAGYNMVQVQVLNGVPSMNIYGQYSMTDGFNFKDINRKGI    120
       ----------HHHHHH---------EEEEEEE----------------------------       
   121 YGYWDHMDYIIKSAASRGIYIGMVCIWGTPVEQGLMNEKEAVAYGKFLAERYKDEPNIIW    180
       EE----HHHHHHHH----EEEEEEEEE--------HHHHHHHHHHHHHHHH------EEE       
   181 MIGGDIRGDNKTEVWDALANSIRSIDKGHLMTFHPRGRTTSATWFNDREWLDFNMFQSGH    240
       EE-----------HHHHH--HHHHH----EEEE---------EE---HHHHHHHHHH---       
   241 RRYGQRNGDGDYPIEENTEEDNWRFVEASQAKTPLKPVIDDEPIYEDIPQGLHDPNETRW    300
       ----------------------HHHHHHH-------------------------------       
   301 NQHDVRRYAYWSVFAGSFGHSYGHNDIMQFIRPGYGASFGADGRKKAWWDALEDPGFNQM    360
       ----EEEEEEEEEEE-----------EEEEE-------------HHHHHHH-----HHHH       
   361 KYLKNLMLTFPFFERVPDQSVIAGTNGERYDRAIATRGNDYLLVYNYSGRPMQIDLSKIS    420
       HHHHHH-------------EEEE------HHHHHH-----EEEEEE------EEHHHHH-       
   421 GAKKNAWWYSAKDGKLEYIGEFDSKVTSFQHDSGYLSGNDQVLIVVDSAKDYVQKAWTAL    480
       -----HHHH------EEEEEE----EEEEE----------EEEEEEE---HHHHHHHH--       
   481 PDAIQKWNK                                                       489
       HHHHH----       

Secondary structure: H - alpha helix, E - beta strand

Notes
Secondary structure prediction is done using JNET: A Neural Network Protein Secondary Structure Prediction Method.
Contact Webmaster JCSG Menu