LOADING...
   YP_001297591.1;GS13522A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001297591.1    Secondary Structure Prediction




   Transmembrane helix      alpha-helix      beta-strand    

Secondary Structure Map

>YP_001297591.1 gi|150002847|ref|YP_001297591.1| hypothetical protein BVU_0247 [Bacteroides vulgatus ATCC 8482]
     1 MKLKNLFTCTVTGLLLCTSCIKDEAPNAEADILNCILPAEMLTGTDIDYNRPYDKSLNAY     60
       -----EEEEEEEEEEE------------HHHHHHHH------------------------       
    61 PIYIEVNNGTDLTRLAPTFELTEGASIEPANGSTQNFTNPVRYTVTSEDKNWHRTYAINI    120
       EEEEEE-------E--------------------------EEEEEEE------EEEEEE-       
   121 HYPETKSIPTVFNFENVKTVPYNKNEYYVLYEAASGYSTLTWSSGNQGFALTGSGYTPND    180
       ---------EEEEE---EE------EEEEEEEE-----EEEEE-----EEE---------       
   181 FPTSISPNGRTGNCLQLITRKTGSLGTLVGMPIAAGNLFIGSFDIGSAMSDALSATKFGT    240
       -------------EEEEEEE------EEE---------E----------HHHHHHHH---       
   241 TFYYEPIKLVGYYKYKAGPEFYENGESTNRKDVFNIYALFYEKTKDVQMLDGHIAKNNYE    300
       EEEEE--EEEEEEE-----------------HHHHHHHHHHHH--HHHHHHHHHHH----       
   301 HENMVAAAVITDTHETSEWTRFELDFNYEHYGKTIDPQKLANGGYNVSIVLSASKDGDVF    360
       HHHEEEEEEE-------HHHHHHHH--------------------EEEEEEE------EE       
   361 QGAPGSTLLIDDLELVCKQPLR                                          382
       E------EEHHHHHHHH-----       

Secondary structure: H - alpha helix, E - beta strand

Notes
Secondary structure prediction is done using JNET: A Neural Network Protein Secondary Structure Prediction Method.
Contact Webmaster JCSG Menu