LOADING...
   YP_001087438.1;SP19352A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001087438.1    Secondary Structure Prediction




   Transmembrane helix      alpha-helix      beta-strand    

Secondary Structure Map

>YP_001087438.1 gi|126698541|ref|YP_001087438.1| putative phage lipoprotein [Clostridium difficile 630]
     1 MKKKVCFLFSILIVICLAIVGCSNSESPEESSKNNEPKKEEKKDKEVVIGEKIISDKMEI     60
       ----EEEEEHHHHEEEEEEE-------------------------EEEEEEEE----EEE       
    61 TINNIEFSYDVLPKVKESLYTHYPAESGKVYIDIAADIKNTQKQELNCSDLLTIEANYND    120
       EEE-------------------------EEEEEEEEE--------------HHHHHH---       
   121 GYKYSSQTIVEDETTGFTYDNISSIDPLETKGVRFIIDCPDEVKTSDKPVILSFTFDGNK    180
       ------EEEEEE-----EE-------------EEEEEE----------EEEEEEE----E       
   181 YVYKMK                                                          186
       EEE---       

Secondary structure: H - alpha helix, E - beta strand

Notes
Secondary structure prediction is done using JNET: A Neural Network Protein Secondary Structure Prediction Method.
Contact Webmaster JCSG Menu