LOADING...
   TM1612;TM1612
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1612    Secondary Structure Prediction




   Transmembrane helix      alpha-helix      beta-strand    

Secondary Structure Map

>TM1612 TM1612 ATP synthase F1, subunit alpha (atpA)
     1 MRINPGEITKVLEEKIKSFEEKIDLEDTGKVIQVGDGIARAYGLNKVMVSELVEFVETGV     60
       -------HHHHHHHHHHHHHHHH------EEEEE---HHHHHH--EEEEEEEEEEEEE--       
    61 KGVAFNLEEDNVGIIILGEYKDIKEGHTVRRLKRIIEVPVGEELLGRVVNPLGEPLDGKG    120
       --EEEE-----EEEEEE---------HHHHHHEEEEEE--------EE------------       
   121 PINAKNFRPIEIKAPGVIYRKPVDTPLQTGIKAIDSMIPIGRGQRELIIGDRQTGKTAIA    180
       ---------EEE----EEEE-----------EE-----------EEEEE-------EEEE       
   181 IDTIINQKGQGVYCIYVAIGQKKSAIARIIDKLRQYGAMEYTTVVVASASDPASLQYIAP    240
       EEEEE-----EEEEEEEE----HHHHHHHHHHHHHH---EEEEEEEE-------HHHHHH       
   241 YAGCAMGEYFAYSGRDALVVYDDLSKHAVAYRQLSLLMRRPPGREAYPGDIFYLHSRLLE    300
       H-----HHHH------EEEEE----HHHHHHHHHHHHH------------HHHHHHHHHH       
   301 RAVRLNDKLGGGSLTALPIVETQANDISAYIPTNVISITDGQIYLEPGLFYAGQRPAINV    360
       HHHHHH--------E--EEEE------EEE----EEEE----EE-------------EEE       
   361 GLSVSRVGGSAQIKAMKQVAGMLRIDLAQYRELETFAQFATELDPATRAQIIRGQRLMEL    420
       ---E-----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHH       
   421 LKQEQYSPMPVEEQVVVLFAGVRGYLDDLPVEEVRRFEKEFLRFMHEKHQDILDDIKTKK    480
       HHHH-------EEEEEEEEE----------HHHHHHHHHHHHHHHH-----HHHHHH---       
   481 ELTSETEEKLKKAIEEFKTTFRV                                         503
       ----HHHHHHHHHHHHHH-----       

Secondary structure: H - alpha helix, E - beta strand

Notes
Secondary structure prediction is done using JNET: A Neural Network Protein Secondary Structure Prediction Method.
Contact Webmaster JCSG Menu