LOADING...
   TM1526;TM1526
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1526    Secondary Structure Prediction




   Transmembrane helix      alpha-helix      beta-strand    

Secondary Structure Map

>TM1526 TM1526 hypothetical protein
     1 MKVSDILTVAIRLEEEGERFYRELSEHFNGEIKKTFLELADQERIHAEIFRKMSDQENWD     60
       -----HHHHHHHHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHHHHHH--------       
    61 EVDSYLAGYAFYEVFPDTSEILRRKDLTLKEVLDIAISVEKDSIILYYELKDGLVNSDAQ    120
       -HHHHHHH-EEEEE----HHHHHHHHHHHHHHHHHHHHHH--EEEEHHHH----------       
   121 KTVKKIIDQEKEHLRKLLEMKREST                                       145
       HHHHHHHHHHHHHHHHHHHH-----       

Secondary structure: H - alpha helix, E - beta strand

Notes
Secondary structure prediction is done using JNET: A Neural Network Protein Secondary Structure Prediction Method.
Contact Webmaster JCSG Menu