LOADING...
   TM1394;TM1394
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1394    Secondary Structure Prediction




   Transmembrane helix      alpha-helix      beta-strand    

Secondary Structure Map

>TM1394 TM1394 conserved hypothetical protein
     1 MIYYGTMFDHKVRFSIVRMREVVEEARNRHALSYLATVVLGRALIGAALVTPWLAEKERW     60
       -----------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHHH---       
    61 TLDIEGNGPIRRVVAQSTSEFTVRGYVANPKVELPLNEKGKFDVAGAIGQGVLRVVRDLG    120
       EEE------EEEEEEE----EEEEEEE----------------EE-----EEEEEEEE--       
   121 LKTPFVSQVPLVSGEIAEDLAYYFAVSEQIPSAFSIGVLVDSDGVKIAGGFAVQIIDRTL    180
       -----E--------HHHHHHHHHHHHHH------EEEEEE-----EE---EEEEEHHHHH       
   181 EQEKVEMIEKNIKNLPSISKLFQEAEPLDVLERIFGEKVGFVETAEIKYKCDCNREKAKN    240
       HHHHHHHHHHH--------HHHHHH---HHHHHHHH----EEEEHHHHH-----HHHHHH       
   241 ALLVLDKKELEDMRKEGKGEVVCKWCNTRYVFSEEELEELLKFKVDDSGS              290
       HHHHHHHHHHHHHH-----EEEEEE---EEE-HHHHHHHHHHHH------       

Secondary structure: H - alpha helix, E - beta strand

Notes
Secondary structure prediction is done using JNET: A Neural Network Protein Secondary Structure Prediction Method.
Contact Webmaster JCSG Menu