LOADING...
   TM1158;TM1158
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1158    Secondary Structure Prediction




   Transmembrane helix      alpha-helix      beta-strand    

Secondary Structure Map

>TM1158 TM1158 conserved hypothetical protein
     1 MRVLAIRHVEIEDLGMMEDIFREKNWSFDYLDTPKGEKLERPLEEYSLVVLLGGYMGAYE     60
       -----HHHHHHHH---HHHHHHH--------------------HHHHHHHHH------HH       
    61 EEKYPFLKYEFQLIEEILKKEIPFLGICLGSQMLAKVLGASVYRGKNGEEIGWYFVEKVS    120
       HH---HHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHH--------EEEEEEEEE--       
   121 DNKFFREFPDRLRVFQWHGDTFDLPRRATRVFTSEKYENQGFVYGKAVGLQFHIEVGART    180
       -----------EEEEE------------EEEEEE--------EE------EEHHHHHHHH       
   181 MKRWIEAYKDELEKKKIDPRLLLETAEREEKVLKGLLRSLLERMVES                 227
       HHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHH----       

Secondary structure: H - alpha helix, E - beta strand

Notes
Secondary structure prediction is done using JNET: A Neural Network Protein Secondary Structure Prediction Method.
Contact Webmaster JCSG Menu