LOADING...
   TM1040;TM1040
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1040    Secondary Structure Prediction




   Transmembrane helix      alpha-helix      beta-strand    

Secondary Structure Map

>TM1040 TM1040 histidinol-phosphate aminotransferase (hisC)
     1 MNPLDLIAKRAYPYETEKRDKTYLALNENPFPFPEDLVDEVFRRLNSDALRIYYDSPDEE     60
       ----HHHHHH------------EEE------------HHHHHHHH---EEEEE-----HH       
    61 LIEKILSYLDTDFLSKNNVSVGNGADEIIYVMMLMFDRSVFFPPTYSCYRIFAKAVGAKF    120
       HHHHHHHHHH---------E------HHHHHHHHH------------HHHHHHHHHHHH-       
   121 LEVPLTKDLRIPEVNVGEGDVVFIPNPNNPTGHVFEREEIERILKTGAFVALDEAYYEFH    180
       -E----------EEE-----EEEE----------HHHHHHHHHHHHHHHHHHHHHHHHH-       
   181 GESYVDFLKKYENLAVIRTFSKAFSLAAQRVGYVVASEKFIDAYNRVRLPFNVSYVSQMF    240
       ---HHHHHHHHHHHHHHHHHHHHHHHHHHH---EEEHHHHHHHHHHH------HHHHHHH       
   241 AKVALDHREIFEERTKFIVEERERMKSALREMGYRITDSRGNFVFVFMEKEEKERLLEHL    300
       HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---EEE-----EEEEEHHHHHHHHHHHHH       
   301 RTKNVAVRSFREGVRITIGKREENDMILRELEVFK                             335
       HHHHHEEEE-----EEEE------HHHHHHH----       

Secondary structure: H - alpha helix, E - beta strand

Notes
Secondary structure prediction is done using JNET: A Neural Network Protein Secondary Structure Prediction Method.
Contact Webmaster JCSG Menu