LOADING...
   TM1009;TM1009
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1009    Secondary Structure Prediction




   Transmembrane helix      alpha-helix      beta-strand    

Secondary Structure Map

>TM1009 TM1009 oxidoreductase, aldo/keto reductase family
     1 MQVPKVTLNNGVEMPILGYGVFQIPPEKTEECVYEAIKVGYRLIDTAASYMNEEGVGRAI     60
       -----EE-----EEEE----EE--------HHHHHHHHH--EEEHHHHHHHHHHHHHHHH       
    61 KRAIDEGIVRREELFVTTKLWVSDVGYESTKKAFEKSLKKLQLEYIDLYLIHQPFGDVHC    120
       HHHHHHHHHHHHHHEEEEEEEE--------HHHHHHHHHHHHHHHHHHHHH------HHH       
   121 AWKAMEEMYKDGLVRAIGVSNFYPDRLMDLMVHHEIVPAVNQIEIHPFYQRQEEIEFMRN    180
       HHHHHHHHHH---EEEE--------HHHHHHHHHH--------------HHHHHHHHHH-       
   181 YNIQPEAWGPFAEGRKNIFQNGVLRSIAEKYGKTVAQVILRWLTQKGIVAIPKTVRRERM    240
       ----------------HHHHHHHHHHHHHH---EEEEHHHHHHHH--EEEE--HHHHHHH       
   241 KENISIFDFELTQEDMEKIATLDEGQSAFFSHRDPEVVKWICSLKR                  286
       HHHHHHHHHHHHHHHHHHHHHH-----EE------EEEEEEE----       

Secondary structure: H - alpha helix, E - beta strand

Notes
Secondary structure prediction is done using JNET: A Neural Network Protein Secondary Structure Prediction Method.
Contact Webmaster JCSG Menu