LOADING...
   TM0828;TM0828
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0828    Secondary Structure Prediction




   Transmembrane helix      alpha-helix      beta-strand    

Secondary Structure Map

>TM0828 TM0828 sugar kinase, pfkB family
     1 MVLTVTLNPALDREIFIEDFQVNRLYRINDLSKTQMSPGGKGINVSIALSKLGVPSVATG     60
       ---EEE------HHHHHHHHHHHHHHHH--------------EEEEEEEE-----EEEEE       
    61 FVGGYMGKILVEELRKISKLITTNFVYVEGETRENIEIIDEKNKTITAINFPGPDVTDMD    120
       E-----HHHHHHHHHHHHHEEEEEEEEEE-----EEEEEE----EEEEE-----------       
   121 VNHFLRRYKMTLSKVDCVVISGSIPPGVNEGICNELVRLARERGVFVFVEQTPRLLERIY    180
       HHHHHHHHHHH--E--EEEEE----------HHHHHHHHHH---EEEEEE----HHHHH-       
   181 EGPEFPNVVKPDLRGNHASFLGVDLKTFDDYVKLAEKLAEKSQVSVVSYEVKNDIVATRE    240
       -----------------------------HHHHHHHHHHH---EEEEEEEE---EEEE--       
   241 GVWLIRSKEEIDTSHLLGAGDAYVAGMVYYFIKHGANFLEMAKFGFASALAATRRKEKYM    300
       -EEEE--------HHHH----HHHHHEEEEEE-----HHHHHHHHHHHHHHHHHHH----       
   301 PDLEAIKKEYDHFTVERVK                                             319
       --HHHHHHH---EEEE---       

Secondary structure: H - alpha helix, E - beta strand

Notes
Secondary structure prediction is done using JNET: A Neural Network Protein Secondary Structure Prediction Method.
Contact Webmaster JCSG Menu