LOADING...
   TM0312;TM0312
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0312    Secondary Structure Prediction




   Transmembrane helix      alpha-helix      beta-strand    

Secondary Structure Map

>TM0312 TM0312 conserved hypothetical protein
     1 MKPLRKIRLGIVGCGIAARELHLPALKNLSHLFEITAVTSRTRSHAEEFAKMVGNPAVFD     60
       -----HHHH-----HHHHHHHHHHHHHH---EEEEEEEE-----HHHHHHHHH-------       
    61 SYEELLESGLVDAVDLTLPVELNLPFIEKALRKGVHVICEKPISTDVETGKKVVELSEKS    120
       -HHHHHHHHHHHHHH---------HHHHHHHH---EEEEE------E----EEEEEE---       
   121 EKTVYIAENFRHVPAFWKAKELVESGAIGDPVFMNWQIWVGMDENNKYVHTDWRKKPKHV    180
       -EEEEEE------HHHHHHHHHHHH------EEEEEEEEEE------EEEE---------       
   181 GGFLSDGGVHHAAAMRLILGEIEWISAVAKDLSPLLGGMDFLSSIFEFENGTVGNYTISY    240
       -------HHHHHHHHHHHHHHHHHHHHHHHH-----------EEEEEE-------EEEEE       
   241 SLKGNERFEITGTKGKISISWDKIVLNEEEMKVPQENSYQKEFEDFYQVVAEGKPNDLGS    300
       E-----EEEEE----EEEE----HHHHHHH----------HHHHHEEEEEE---------       
   301 PVQALKDLAFIEACVRSAGNKVFVSSLL                                    328
       HHHHHHHHHHHHHHHHH----EEEE---       

Secondary structure: H - alpha helix, E - beta strand

Notes
Secondary structure prediction is done using JNET: A Neural Network Protein Secondary Structure Prediction Method.
Contact Webmaster JCSG Menu