LOADING...
   TM0231;TM0231
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0231    Secondary Structure Prediction




   Transmembrane helix      alpha-helix      beta-strand    

Secondary Structure Map

>TM0231 TM0231 UDP-N-acetylmuramate--alanine ligase (murC)
     1 MKIHFVGIGGIGMSAVALHEFSNGNDVYGSNIEETERTAYLRKLGIPIFVPHSADNWYDP     60
       ---EEEEE-----EEHHHHH------------HHHHHHHHHHH----EEE----------       
    61 DLVIKTPAVRDDNPEIVRARMERVPIENRLHYFRDTLKREKKEEFAVTGTDGKTTTTAMV    120
       --EEE---------HHHHHHHHHHHHHHH------HHHHHH-EEEEEE------EEEHHH       
   121 AHVLKHLRKSPTVFLGGIMDSLEHGNYEKGNGPVVYELDESEEFFSEFSPNYLIITNARG    180
       HHHHHH-----EEEEE-----------------EEEEE-------------EEEEE----       
   181 DHLENYGNSLTRYRSAFEKISRNTDLVVTFAEDELTSHLGDVTFGVKKGTYTLEMRSASR    240
       ----------HHHHHHHHHH-----EEEEEE----------EEEEE----EEHHHHHHHH       
   241 AEQKAMVEKNGKRYLELKLKVPGFHNVLNALAVIALFDSLGYDLAPVLEALEEFRGVHRR    300
       HHHHHHHHH---HHHHHHH-------HHHHHHHHHHHH------HHHHHHHHHHHH---E       
   301 FSIAFHDPETNIYVIDDYAHTPDEIRNLLQTAKEVFENEKIVVIFQPHRYSRLEREDGNF    360
       EEEEE-----EEEEE-------HHHHHHHHHHHHHHH--EEEEEE--------------H       
   361 AKALQLADEVVVTEVYDAFEEKKNGISGKMIWDSLKSLGKEAYFVEKLPELEKVISVSEN    420
       HHHHHHH--EEEEEEHHHHHHH------EEEHHHHH----HHHHH------EEEEEE---       
   421 TVFLFVGAGDIIYSSRRFVERYQSSKSSPSRVLGSNK                           457
       EEEEEE----EEE---EEEEEE--------EE-----       

Secondary structure: H - alpha helix, E - beta strand

Notes
Secondary structure prediction is done using JNET: A Neural Network Protein Secondary Structure Prediction Method.
Contact Webmaster JCSG Menu