LOADING...
   YP_001337146.1;SP18574A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001337146.1    Secondary Structure Prediction




   Transmembrane helix      alpha-helix      beta-strand    

Secondary Structure Map

>YP_001337146.1 gi|152972000|ref|YP_001337146.1| hypothetical protein KPN_03484 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
     1 MNLPKALVLTVAATTFCLMTSPAFAVEETTPQNMTCQEFMDMNPKSMTPVAFWVVNRNTD     60
       ------EEEEEEEEEEE------EEEE--------HHHH---------EEEEEEE-----       
    61 FSGGDYVDWHEVETVSVPKMLQECHKNPAAKLGDLSAVIKK                       101
       -----EEEEEEEEEE---------------------EE---       

Secondary structure: H - alpha helix, E - beta strand

Notes
Secondary structure prediction is done using JNET: A Neural Network Protein Secondary Structure Prediction Method.
Contact Webmaster JCSG Menu