LOADING...
   NP_904517.1;C.KN20883A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_904517.1    Secondary Structure Prediction




   Transmembrane helix      alpha-helix      beta-strand    

Secondary Structure Map

>NP_904517.1 gi|34540038|ref|NP_904517.1| immunoreactive 32 kDa antigen PG49 [Porphyromonas gingivalis W83]
     1 MKKYLLYASLLTSVLLFSCSKNNPNEPVEDRSIEISIRVDDFTKTGEAVRYERNQGSAAE     60
       ----HHHHHH--EEEEEE--------------EEEEEEE---------HHHHH----HHH       
    61 RLITNLYLLLFDQSGANPAKYYITGNTFTGGTWLPDDMKVKLDMTQSEAGERKVYVVANV    120
       HHHHHHHHHHHH------EEEEEE--------------EEEE---------EEEEEEEE-       
   121 DNAVKTALDAVANESDLQTVKRTTAMPWSTDIASPFLMSGNKTHDFLANRLLDNVPLVRA    180
       ---HHHHHHHHH-----EEEEEEE--------------------HHHHHHH----HHHHH       
   181 IAKVELNISLSEKFQIVPIIVNGSLSEFKFRYVNFDKETYVVKPTTKPDNLISSANGVWP    240
       HHHHHHHHHH---EEEEEEEE------EEEEEE----EEEEEE--------EE-------       
   241 QITDWTVWGASLNTSPAPDAGTGYTLDANGKVTALRIVTYLNERDSKGATVEVALPRVDD    300
       EEEEEEEE---------------EEEE----EEEEEEEEEEE-------EEEEEE-----       
   301 GTLPPPEFGPELYRLPLPDKILRNHWYKYEVEI                               333
       -------------------HHHHH---------       

Secondary structure: H - alpha helix, E - beta strand

Notes
Secondary structure prediction is done using JNET: A Neural Network Protein Secondary Structure Prediction Method.
Contact Webmaster JCSG Menu