LOADING...
   NP_811570.1;C.KN13462A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_811570.1    Secondary Structure Prediction




   Transmembrane helix      alpha-helix      beta-strand    

Secondary Structure Map

>NP_811570.1 gi|29348067|ref|NP_811570.1| hypothetical protein BT2657 [Bacteroides thetaiotaomicron VPI-5482]
     1 MHNKKRNIISGFISTVLGIVLINFAFSSCERIYEDLAPCPHGVSLRFIYDYNMEYANAFA     60
       ------EEEEEEEEEEEEEEEEE-------HHHH---------EEEEEEE--HHHHHHHH       
    61 KKVDCLTLLVYDENGNYVDTRIVTGTELQDENYRMKLDLKQGNYHFVAYGGLACNKSSFL    120
       HH--EEEEEEE-----EEEEEEEE-----HHHHHHHHHHH---EEEEEE--------EEE       
   121 MKYTPGEGTGYTDLQVELDSECLTNPRRKNLHGLYWGELTLATADLYSEGTVEMMKNTNN    180
       EEE---------EEEEE-------------------HHHHHHHHHH----EEEEEE----       
   181 IRVVLQQMNGEPVDDKKFEFEITDDNILFSYDNNLLENGMVTYTPWAQGQASAGFTDEGR    240
       EEEEEE-----------EEEEE----EEE-----------EEE-----------------       
   241 EVVVAYAELSTSRLMVRDWYSPKLTVRRKADGVEIINIPLINYLLMLKSDLYASMDSQEF    300
       EEEEEEE-----EEEE-------EEEEE----EEEEE--HHHHHHHHHHHHHHH---HHH       
   301 LDRESEWSMIFFLSPNLEWIKTYIKINDWTVRINDIRQ                          338
       HHH----EEEEE------EEEEEEEE---EEEE-----       

Secondary structure: H - alpha helix, E - beta strand

Notes
Secondary structure prediction is done using JNET: A Neural Network Protein Secondary Structure Prediction Method.
Contact Webmaster JCSG Menu