LOADING...
   NP_811172.1;GS13194A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_811172.1    Secondary Structure Prediction




   Transmembrane helix      alpha-helix      beta-strand    

Secondary Structure Map

>NP_811172.1 gi|29347669|ref|NP_811172.1| hypothetical protein BT2259 [Bacteroides thetaiotaomicron VPI-5482]
     1 MIMKKKILAYALSALTCGLFTSCSDWLDINHDPNTAEKVDPGYLFNYVAVNWAGTRTGGD     60
       ---HHHHHHHHHHHHH---E----------------EE----EEEEEEEEE---------       
    61 FYIPLSMSSQCQVDGGLDYGGWDESVYTISPYSTGNTWKHYYSVGGNNLMLAIKNAEEAD    120
       EEEE--------------------EEEEE-------EEEEEEE-----HHHHHHH-----       
   121 PVNHNAIAQCKILLAEHMYEATMLWGDIPFTESWNGTIKYPKFDSQESVLNGVLSLLDEA    180
       ----HHHHHHHHHHHHHHHHHHHH-------E-----EE--------HHHHHHHHHHHHH       
   181 LQIMDLNDANAIDEYDIYYKGDMNKWMTLAKSLKFRTLMVMVDKDPSKATAIGTLLQAGG    240
       HHHHHH----HHHHHHHHHH----HHHHHHHHHH-EEEEEEE------HHHHHHHHHH--       
   241 MVSSASDNLVFPYSAEPGNQNPKYELIELVGGTQILFFASNYMLKPMQERNDPRIPCYFE    300
       -E-------EE------------EEEEEE----EEEEHHHH-------------------       
   301 PGADGVYRGLGNREPAVTDDKDNMLSSVVSSYLFRKDAPELIYSCQEQLLLEAEAYARGL    360
       ------E-----------------EEEEEEEEE-------HHHHHHHHHHHHHHHHHH--       
   361 GVAQNLSKANELYKKGIREACAFYGVAEADIDTYVTGLPELTALTQEKALYEIHMQQWID    420
       HHHHHHHHHHHHHHHHHHHHHHHHHHHH-----EE----HHHHHHHHHHHHHHHHHHHHH       
   421 LMDRPFEEFVQWRRSGTAGNEVPTLQVPEDATSKELIRRWEYSPEEMTANINAPKESPKI    480
       H------EEEEE------------E-------HHHHHHHH------------------HH       
   481 WEKLWFDL                                                        488
       HHH-----       

Secondary structure: H - alpha helix, E - beta strand

Notes
Secondary structure prediction is done using JNET: A Neural Network Protein Secondary Structure Prediction Method.
Contact Webmaster JCSG Menu