LOADING...
   NP_810851.1;FR15002A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_810851.1    Secondary Structure Prediction




   Transmembrane helix      alpha-helix      beta-strand    

Secondary Structure Map

>NP_810851.1 gi|29347348|ref|NP_810851.1| hypothetical protein BT1938 [Bacteroides thetaiotaomicron VPI-5482]
     1 MSGTAEVNPITVDVYLDITVENISTLKDLTVKFDNYDEDLHYVKEVTDNSVKVDGIIPGI     60
       -----EE--EEEEEEEEEEEEEEE-----EEEE-------EEEEEEE---EEE--EE--E       
    61 YSVTVSGTAIDTENNEYYINGNSVNAALFKHGSALNIEVQGLKVSPLIFKEIYYCGSRPE    120
       EEEEE--EEE-----EEEE----HHHHHHH---HHHHHHHH------EEEEEEE------       
   121 KGGVYFRDQFYEIYNNSADILYLDGIYFANLTPGTATTKLPIWPEADGNNYAYGERVWKF    180
       ---EEEEEEEEEE-----EEEE---EEEE-----------------------EEEEEEE-       
   181 PGNGTEYPLAPGESCIISQFAANHQLDIYNPQSPIDGSSSEFEFNMNNPNFPDQAAYDMQ    240
       ---------------HHHHHHHHH-----------------------------HHHHHHH       
   241 HVFYQGKAEMGSIPQYLTSVFGGAYVIFRVPEGEAWDPVNDENMKTTDLSKPNSNVYYAK    300
       HHHHH----------EEEEEE--EEEEEE--------------------------EEEEE       
   301 IPIKYVLDAVEAVNNESKMNAKRVPGVLDAGITWVGATYCGLGIARKLSTDEEGNPIIRE    360
       --EEEEHHHHHHH-------------E----EEEE-------EEEEE---------EEEE       
   361 ETGTYIYQDTNNSTDDFERGVVPVMRRNGAKMPSWNHTL                         399
       ---EEEEE------------EEEEEE-------------       

Secondary structure: H - alpha helix, E - beta strand

Notes
Secondary structure prediction is done using JNET: A Neural Network Protein Secondary Structure Prediction Method.
Contact Webmaster JCSG Menu