LOADING...
   NP_809759.1;SP16701A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_809759.1    Secondary Structure Prediction




   Transmembrane helix      alpha-helix      beta-strand    

Secondary Structure Map

>NP_809759.1 gi|29346256|ref|NP_809759.1| hypothetical protein BT0846 [Bacteroides thetaiotaomicron VPI-5482]
     1 MKNILFTLFAILILTSCSKDEEDWTELNSNNIIGYWSTGIEGTHKLLSFDEDGTGSFGIY     60
       ---HHHHHHHHHH-----------EE----EEEEEEE------EEEEEE-------EEEE       
    61 SNATPISFQMFDYKIEEGRIYIYDVYPDEKTPYYLDCKISGTTLKVETGSEAGTYKKQK     119
       ------HHHHHHHHHH--EEEEEEE-------EEEEE----EEEEEE------------       

Secondary structure: H - alpha helix, E - beta strand

Notes
Secondary structure prediction is done using JNET: A Neural Network Protein Secondary Structure Prediction Method.
Contact Webmaster JCSG Menu