LOADING...
   NP_809341.1;GE2184A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_809341.1    Secondary Structure Prediction




   Transmembrane helix      alpha-helix      beta-strand    

Secondary Structure Map

>NP_809341.1 gi|29345838|ref|NP_809341.1| phenylacetate-coenzyme A ligase [Bacteroides thetaiotaomicron VPI-5482]
     1 MSTQYWEEEIEIMSREKLQELQLQRLKKTINIAANSPYYKEVFSKNGITGDSIQSLDDIR     60
       ----HHHHHHHHHHHHHHHHHHHHHHHHHHHHH----EEEEEEE----------------       
    61 KIPFTTKSDMRANYPFGLVAGDMKRDGVRIHSSSGTTGNPTVIVHSQHDLDSWANLVARC    120
       ------------------EE-------EEEE---------EEEEE-------HHHHHHHH       
   121 LYMVGIRKTDVFQNSSGYGMFTGGLGFQYGAERLGCLTVPAAAGNSKRQIKFISDFKTTA    180
       HHHHH-----EEE------EE------HHHHHH----EE--------EEEEEE-----HH       
   181 LHAIPSYAIRLAEVFQEEGIDPRETTLKTLVIGAEPHTDEQRRKIERMLNVKAYNSFGMT    240
       HH--HHHHHHHHHHHHH--------EEEEEEE------HHHHHHHHHHHHHHHH-----E       
   241 EMNGPGVAFECQEQNGMHFWEDCYLVEIIDPETGEPVPEGEIGELVLTTLDREMMPLIRY    300
       ------EEEEE------E-----EEEEEE-------------EEEEEEE-------HHHH       
   301 RTRDLTRILPGKCPCGRTHLRIDRIKGRSDDMFIIKGVNIFPMQVEKILVQFPELGSNYL    360
       H-----EE----------EEEEE--------EEEEE-------HHHHHHEE-------EE       
   361 ITLETVNNQDEMIVEVELSDLSTDNYIELEKIRRDIIRQLKDEILVTPKVKLVKKGSLPQ    420
       EEEEEE-----EEEEEE-------HHHHHHHHHHHHHHHHHHHEEE---EEEEE------       
   421 SEGKAVRVKDLRDNK                                                 435
       ---EEEEEEE-----       

Secondary structure: H - alpha helix, E - beta strand

Notes
Secondary structure prediction is done using JNET: A Neural Network Protein Secondary Structure Prediction Method.
Contact Webmaster JCSG Menu