LOADING...
   NP_251743.1;SP16046A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_251743.1    Secondary Structure Prediction




   Transmembrane helix      alpha-helix      beta-strand    

Secondary Structure Map

>NP_251743.1 gi|15598249|ref|NP_251743.1| probable hydrolytic enzyme [Pseudomonas aeruginosa PA01]
     1 MSLPRLSLSLCLALACGPALASQAPVYGERLEGFDYAYPVHYLDFTSQGQPLSMAYLDVA     60
       ----HHHHHHHHHHH-------------------------EE----------HHHHHHH-       
    61 PKKANGRTILLMHGKNFCAGTWERTIDVLADAGYRVIAVDQVGFCKSSKPAHYQYSFQQL    120
       ------EEEEEE----------HHHHHEEEE--EEEEEEE------------HHHHHHHH       
   121 AANTHALLERLGVARASVIGHSMGGMLATRYALLYPRQVERLVLVNPIGLEDWKALGVPW    180
       HHHHHHHHHHHHHHHHH-------HHHHHHHHHH---HHHEEEEE---------------       
   181 RSVDDWYRRDLQTSAEGIRQYQQATYYAGEWRPEFDRWVQMQAGMYRGKGRESVAWNSAL    240
       -------------HHHHHHHHHHHHHHH-------HHHHHHHHHHH------EEE----H       
   241 TYDMIFTQPVVYELDRLQMPTLLLIGEKDNTAIGKDAAPAELKARLGNYAQLGKDAARRI    300
       HHHH-----HHHHH-------EEE-------------HHHHHHHHHHHHHHHHHHHHHH-       
   301 PQATLVEFPDLGHTPQIQAPERFHQALLEGLQTQP                             335
       ---EEEE------------HHHHHHHHHH------       

Secondary structure: H - alpha helix, E - beta strand

Notes
Secondary structure prediction is done using JNET: A Neural Network Protein Secondary Structure Prediction Method.
Contact Webmaster JCSG Menu