LOADING...
   NM_002092;NM_002092
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NM_002092    Secondary Structure Prediction




   Transmembrane helix      alpha-helix      beta-strand    

Secondary Structure Map

>NM_002092 NM_002092 Homo sapiens G-rich RNA sequence binding factor 1 (GRSF1), transcript variant 1, mRNA, coding region:84-1526
     1 MAGTRWVLGALLRGCGCNCSSCRRTGAACLPFYSAAGSIPSGVSGRRRLLLLLGAAAAAA     60
       ----HHHHHHHH--------------------------------HHHHHHHHHHHHHHHH       
    61 SQTRGLQTGPVPPGRLAGPPAVATSAAAAAAASYPALRASLLPQSLAAAAAVPTRSYSQE    120
       HHH-----------------HHHHHHHHHHHHHHHHHHH---HHHHHHHHH---------       
   121 SKTTYLEDLPPPPEYELAPSKLEEEVDDVFLIRAQGLPWSCTMEDVLNFFSDCRIRNGEN    180
       ---EEE----------------HHHHHHHHHHHH--------------------------       
   181 GIHFLLNRDGKRRGDALIEMESEQDVQKALEKHRMYMGQRYVEVYEINNEDVDALMKSLQ    240
       -EEEEE---------HHHHHHHHHHHHHHHHHHHHHH---EEEEEEE---HHHHHHHHHH       
   241 VKSSPVVNDGVVRLRGLPYSCNEKDIVDFFAGLNIVDITFVMDYRGRRKTGEAYVQFEEP    300
       H-----E---EEEE-----------HHHHH----EEEEEEEE----------EEE-----       
   301 EMANQALLKHREEIGNRYIEIFPSRRNEVRTHVGSYKGKKIASFPTAKYITEPEMVFEEH    360
       HHHHHHHHHHHHH----EEEE-------EEEEE------EEE------EE-----EEE--       
   361 EVNEDIQPMTAFESEKEIELPKEVPEKLPEAADFGTTSSLHFVHMRGLPFQANAQDIINF    420
       ----------HHHHHHHHH-------------------EEHHHH---------HHHHHHH       
   421 FAPLKPVRITMEYSSSGKATGEADVHFETHEDAVAAMLKDRSHVHHRYIELFLNSCPKGK    480
       H------EEEEEE----------------HHHHHHHHHH----EEEEEEEEE--------       

Secondary structure: H - alpha helix, E - beta strand

Notes
Secondary structure prediction is done using JNET: A Neural Network Protein Secondary Structure Prediction Method.
Contact Webmaster JCSG Menu