LOADING...
   BC030493;WS20613E
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
BC030493    Secondary Structure Prediction




   Transmembrane helix      alpha-helix      beta-strand    

Secondary Structure Map

>BC030493 BC030493 Mus musculus RNA binding motif protein 39, mRNA (cDNA clone MGC:40964 IMAGE:5400675), complete cds, coding region:452-1555
     1 MQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLAIGLTGQR     60
       ---------------EEE---EEEEEEE----------EEEEEEEE------EE-----E       
    61 VLGVPIIVQASQAEKNRAAAMANNLQKGSAGPMRLYVGSLHFNITEDMLRGIFEPFGRIE    120
       E---EEHHHHHHHHHHHHHHHHHHHH------EEEEE-----HHHHHHHH--------HH       
   121 SIQLMMDSETGRSKGYGFITFSDSECAKKALEQLNGFELAGRPMKVGHVTERTDASSASS    180
       HHHHH-----------EEEE---HHHHHHHHHHH--------------EEE---------       
   181 FLDSDELERTGIDLGTTGRLQLMARLAEGTGLQIPPAAQQALQMSGSLAFGAVADLQTRL    240
       -----HHHHH------HHHHHHHHHHHH-------HHHHHHHHHH--HHHHHHHHHHHHH       
   241 SQQTEASALAAAASVQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHI    300
       HHHHHHHHHHHHHHHHHHHHHHHHHH--------------------EEEEE-----EEEE       
   301 YVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQ    360
       EEE-------EEE---HHHHHHHHHHHHHHHHHHHHEEEEEE---------------EEE       
   361 LLVPSRR                                                         367
       EE-----       

Secondary structure: H - alpha helix, E - beta strand

Notes
Secondary structure prediction is done using JNET: A Neural Network Protein Secondary Structure Prediction Method.
Contact Webmaster JCSG Menu