LOADING...
   BC011707;KN.B21268A.NRBF2
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
BC011707    Secondary Structure Prediction




   Transmembrane helix      alpha-helix      beta-strand    

Secondary Structure Map

>BC011707 BC011707 Homo sapiens nuclear receptor binding factor 2, mRNA (cDNA clone MGC:19778 IMAGE:3687848), complete cds, coding region:99-962
     1 MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQ     60
       --------HHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH       
    61 RDSHMKQLLLIQERWKRAQREERLKAQQNTDKDAAAHLQTSHKPSAEDAEGQSPLSQKYS    120
       HHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHH---------------------       
   121 PSTEKCLPEIQGIFDRDPDTLLYLLQQKSEPAEPCIGSKAPKDDKTIIEEQATKIADLKR    180
       -------------------HHHHHHH-------------------HHHHHHHHHHHHHHH       
   181 HVEFLVAENERLRKENKQLKAEKARLLKGPIEKELDVDADFVETSELWSLPPHAETATAS    240
       HHHHHHHHHHHHHHHHHHHHHHHHHHH---------------------------------       
   241 STWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDILKGFMNN                 287
       -HHHHHHHH----------------------HHHHHHHHHHH-----       

Secondary structure: H - alpha helix, E - beta strand

Notes
Secondary structure prediction is done using JNET: A Neural Network Protein Secondary Structure Prediction Method.
Contact Webmaster JCSG Menu