LOADING...
   AF124247;AF124247
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
AF124247    Secondary Structure Prediction




   Transmembrane helix      alpha-helix      beta-strand    

Secondary Structure Map

>AF124247 AF124247 Homo sapiens hepatocytic transcription factor hB1F-2 (B1F2) mRNA, complete cds, coding region:1-1623
     1 MSSNSDTGDLQESLKHGLTPIGAGLPDRHGSPIPARGRLVMLPKVETEALGLARSHGEQG     60
       ---------HHHHH------------------------EEE---HHHHHHHHHH------       
    61 QMPENMQVSQFKMVNYSYDEDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRY    120
       -----HHHHHHHHH----------------------E--EEEE------EEEEEE----E       
   121 TCIENQNCQIDKTQRKRCPYCRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRALKQ    180
       EEEE------------------HHHHHHHHHHHHHHHHHHHH----------HHHHHHHH       
   181 QKKALIRANGLKLEAMSQVIQAMPSDLTISSAIQNIHSASKGLPLNHAALPPTDYDRSPF    240
       HHHHHHHHH--HHHHHHHHHHH------HHHHHHHHHH----------------------       
   241 VTSPISMTMPPHGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYSYMDSYQTSSPAS    300
       -E---E------------------------------------------------------       
   301 IPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWA    360
       -HHHHHHHH------HHHHHHHHHHHHHHHHH---HHHHHHHHHHHHH--HHHHHHHHHH       
   361 RSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSIIASQA    420
       HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEE----EEEEEE----EEEEHHHHH       
   421 GATLNNLMSHAQELVAKLRSLQFDQREFVCLKFLVLFSLDVKNLENFQLVEGVQEQVNAA    480
       HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------HHHHHHHHHHHHHHHH       
   481 LLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHAKR    540
       HHHHH------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------HHHHHHHHH---       
   541 A                                                               541
       -       

Secondary structure: H - alpha helix, E - beta strand

Notes
Secondary structure prediction is done using JNET: A Neural Network Protein Secondary Structure Prediction Method.
Contact Webmaster JCSG Menu