LOADING...
   13422365;PC07372D
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
13422365    Secondary Structure Prediction




   Transmembrane helix      alpha-helix      beta-strand    

Secondary Structure Map

>13422365 gi|13422365|gb|AAK23049.1| hypothetical protein [Caulobacter crescentus]
     1 MLLSTDIWVAALIRRAELGGAFATVARKGDARAGAVLVKAVDRREGTARLFSEATRGDGE     60
       ----HHHHHHHHHHHHHH--HHHHHHH---HHHHHEEEEEE------EEEEE--------       
    61 RFWMQPVRSTFEPDLDAYAERAARIDPDIWVVEIEDRDGRHFLTEPVES               109
       -EEE----------HHHHHHHHHH----EEEEEE---------------       

Secondary structure: H - alpha helix, E - beta strand

Notes
Secondary structure prediction is done using JNET: A Neural Network Protein Secondary Structure Prediction Method.
Contact Webmaster JCSG Menu