LOADING...
   104161995;ME9797A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
104161995    Secondary Structure Prediction




   Transmembrane helix      alpha-helix      beta-strand    

Secondary Structure Map

>104161995 gi|104161995|emb|CAJ75704.1| predicted HD superfamily hydrolase [uncultured Thermotogales bacterium]
     1 MNLTELMERIPHLREILNIVREAFKDYDDPAHDISHTFRVMENASEIASREKCDLQKAII     60
       ----HHHHHHHHHHHHHHHHHHHH------------EEEE----HHHHHHHHHHHHHHHH       
    61 AALLHDIKRPHEALTGVDHAESGAEYASGLLPTMGFDISFVAEVSKAIRSHRYSGGLTPT    120
       HHHHH------------------HHHH-----------HHHHHHHHHHHH----------       
   121 SLTGKILQDADRLDAIGAVAIARVFSYSGKTGTPLHSLQFSPRSSYSGNSRSSINHFHEK    180
       ----HHHHHHHHHHHHHHHHHHHEEE----------------------------HHHHHH       
   181 ILKIRPETFWTETARKMAEDRYSFVVEFVQRFLAEWGQI                         219
       HHH-------HHHHHHHHH--EEEEHHHHHHHHHH----       

Secondary structure: H - alpha helix, E - beta strand

Notes
Secondary structure prediction is done using JNET: A Neural Network Protein Secondary Structure Prediction Method.
Contact Webmaster JCSG Menu