LOADING...
   YP_095136.1;SP19086A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
                                                                                                                                                                                                        
>YP_095136.1 | 28-403
ALEHEKLVNYIALGEFSRETAEIALKKMPPLDTLTVHYDLQLYKINYKTQSPDGNLTIAS
GLVAMPIHPVGQVGIISYQHGTRFERNDVPSRNNEKNYIYLAAYGNSAGYMTVMPDYLGL
GDNELTLHPYVQAETLASSSIDMLFAAKELANRLHYPISDKLYLAGYSEGGFSTIVMFEM
LAKEYPDLPVSAVAPGSAPYGWEETMHFVMLEPGPRATAYLAYFFYSLQTYKSYWSGFDE
IFAPPYNTLIPELMDGYHAVDEILQALPQDPLLIFQPKFSNGIISKTDRNTEILKINFNH
YDFKPTAPLLLVGTKGDRDVPYAGAEMAYHSFRKYSDFVWIKSVSDALDHVQAHPFVLKE
QVDFFKQFERQEAMNK
Contact Webmaster JCSG Menu