LOADING...
   YP_001337146.1;SP18574A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
                                                                                                                                                                                                        
>SP18574A | 18-48
LMTSPAFAVEETTPQNMTCQEFMDMNPKSMT
Contact Webmaster JCSG Menu