LOADING...
   ZP_03779557.1;BAIE
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_03779557.1    PDB Fold Similairty





PDB sequences with significant alignments
Sequence information                                           Score	E-value
JCSG3283893|pdb|4L8O_A|Bile acid 7a-dehydratase, BaiE             352	9e-98
JCSG3283913|pdb|4LEH_A|Bile acid 7-alpha dehydratase, BaiE        303	4e-83
JCSG3283894|pdb|4N3V_A|Bile acid 7-alpha dehydratase, BaiE        282	9e-77
PDB sequence alignments
QUERY       1   MSIEERLEALEKEIQKMKDIEEIKKLKGQYFRCLDGKFWDELETTLSPNIVTSYSNGKLV 60
JCSG3283893 20  MSIEERLEALEKEIQKMKDIEEIKKLKGQYFRCLDGKFWDELETTLSPNIVTSYSNGKLV 79
JCSG3283913 20  MTLEERVEALEKELQKMKDIEaIKELKGKYFRCLDGKMWDELETTLSPNIVTSYSNGKLV 79
JCSG3283894 20  MTLEaRIEALEKEIQRLNDIEaIKQLKAKYFRCLDGKLWDELETTLSPNIeTSYSDGKLV 79

QUERY       61  FHGPKEVTDYFKKAMPREEISMHMGHTPEITIDSETTATGRWYLEDKLIFTEESKYAGSG 120
JCSG3283893 80  FHGPKEVTDYFKKAMPREEISMHMGHTPEITIDSETTATGRWYLEDKLIFTEESKYAGSG 139
JCSG3283913 80  FHSPKEVTDYLKSTMPKEEISMHMGHTPEITIDSETTATGRWYLEDKLIFT-DGKYkdvG 138
JCSG3283894 80  FHSPKEVTEYLaaAMPKEEISMHMGHTPEITIDSENTATGRWYLEDNLIFT-DGKYkNvG 138

QUERY       121 VNGGAFYTDKYEKVDGKWYILETGYLRVYEEHFMRDPKIKITMNMHKTK 169
JCSG3283893 140 VNGGAFYTDKYEKVDGKWYILETGYLRVYEEHFMRDPKIKITMNMHKTK 188
JCSG3283913 139 INGGAFYTDKYEKIEGQWYILETGYVRIYEEHFMRDPKIhITMNMHK-- 185
JCSG3283894 139 INGGAFYTDKYEKIDGQWYIkETGYVRIFEEHFMRDPKIhITsNMHKeK 187

Note
Homologous search is done using BLAST from NCBI BLAST against database pdbnr with expect (E-value cut-off) at 0.001. The structure of a PDB sequence may be fully or partly solved. The non-redundant database pdbnr consists of unique PDB sequences from the representative PDB chains. Each representative chain has the best structural coverage in the set of the same sequences. You could click a sequence ID to see all of PDB chains associated with the sequence ID plus sequence alignments and structural coverages.



Contact Webmaster JCSG Menu