LOADING...
   ZP_02072838.1;SP13297C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02072838.1    PDB Fold Similairty





PDB sequences with significant alignments
Sequence information                                           Score	E-value
JCSG3297678|pdb|4Q53_B|Uncharacterized protein                    224	2e-59
JCSG3295644|pdb|4OUQ_A|Uncharacterized protein                    170	2e-43
JCSG3294456|pdb|4ORL_A|Uncharacterized protein                    155	9e-39
PDB sequence alignments
QUERY       22  QNVPEGVIGAFKEGNSQELNKYLGDKVDLIIQNKSTHADKRTAEGTMAAFFSNHKVGSFN 81
JCSG3297678 2   QNVPEGVIGAFKEGNSQELNKYLGDKVDLIIQNKSTHADKRTAEGTMAAFFSNHKVGSFN 61
JCSG3295644 2   QDIPvGVVvAFKKGNSQELNRYLGEKVNLVIQNRSesVDRQAAEGTLAAFFSSNKVSGFN 61
JCSG3294456 2   QEIPaGVItAFKRGSSQELSKYMGDKVNLVFQGRSTNVDKQkAtAAMqeFFTKNKVSGFN 61

QUERY       82  VNHQGKRDESGFVIGILMTANGNFRVNCFFRKVQNKYVIHQIRIDKTDE 130
JCSG3297678 62  VNHQGKRDESGFVIGILMTANGNFRVNCFFRKVQNKYVIHQIRIDKTDE 110
JCSG3295644 62  VNHEGKRDESSFIIGtLtTANGNFRINCFFRRVQNKYLINQIRIDKTNE 110
JCSG3294456 62  VNHQGKRDESSFVIGtLaTTNGNFRVNCFLKKVQNQYLIHQIRIDKiNE 110

Note
Homologous search is done using BLAST from NCBI BLAST against database pdbnr with expect (E-value cut-off) at 0.001. The structure of a PDB sequence may be fully or partly solved. The non-redundant database pdbnr consists of unique PDB sequences from the representative PDB chains. Each representative chain has the best structural coverage in the set of the same sequences. You could click a sequence ID to see all of PDB chains associated with the sequence ID plus sequence alignments and structural coverages.



Contact Webmaster JCSG Menu