LOADING...
   ZP_02067971.1;ZP_02067971.1
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02067971.1    PDB Fold Similairty





PDB sequences with significant alignments
Sequence information                                           Score	E-value
JCSG3248701|pdb|4EPS_A|hypothetical protein                       1046	0.0
PDB sequence alignments
QUERY       26  EEEVPGNVRNGIVLNVTDTGIISNEPSTRTEDTGFVTTFTQGDQIGLFAVKDGAILDEIN 85
JCSG3248701 2   EEEVPGNVRNGIVLNVTDTGIISNEPSTRTEDTGFVTTFTQGDQIGLFAVKDGAILDEIN 61

QUERY       86  NMPFTFNGSSWSGKPILYDDRLVGVNFYAYYPYQSEMTGKTDLIGDDFFAPLAAGWELTT 145
JCSG3248701 62  NMPFTFNGSSWSGKPILYDDRLVGVNFYAYYPYQSEMTGKTDLIGDDFFAPLAAGWELTT 121

QUERY       146 EQSDQKAYAKQDLMTSNATALIGENGNYSLSFQLTHRMSLVVVKLPSTRYIFTDAEGVAM 205
JCSG3248701 122 EQSDQKAYAKQDLMTSNATALIGENGNYSLSFQLTHRMSLVVVKLPSTRYIFTDAEGVAM 181

QUERY       206 PEETPYVAMSVDVAFYLDNVEEGTKISPYYDAKKDEYRLLRKPSSENQIIGHYNDKQCTL 265
JCSG3248701 182 PEETPYVAMSVDVAFYLDNVEEGTKISPYYDAKKDEYRLLRKPSSENQIIGHYNDKQCTL 241

QUERY       266 DTAEKMKEGKYKRFVVDGGYKEVTHHLQVGDYYYADGSVVSGNEAEPAKDNCIGIVCWVG 325
JCSG3248701 242 DTAEKMKEGKYKRFVVDGGYKEVTHHLQVGDYYYADGSVVSGNEAEPAKDNCIGIVCWVG 301

QUERY       326 NPMPSVLYKDVAGTPYTATNDALLRSHPNCVHGLVMSLYTETGKFSPALTQSIHDWFMTT 385
JCSG3248701 302 NPMPSVLYKDVAGTPYTATNDALLRSHPNCVHGLVMSLYTETGKFSPALTQSIHDWFMTT 361

QUERY       386 SFTSSYVSVTGYYDANENNKNKPLRFLGYNNSEVLDLYYDTFKTDFECFQYQDDCESSFP 445
JCSG3248701 362 SFTSSYVSVTGYYDANENNKNKPLRFLGYNNSEVLDLYYDTFKTDFECFQYQDDCESSFP 421

QUERY       446 SPSITTGWYVPSSGELVALQDKDNSLESKLNTKLIKVSDKTMDISATYWSSTERNNKNMY 505
JCSG3248701 422 SPSITTGWYVPSSGELVALQDKDNSLESKLNTKLIKVSDKTMDISATYWSSTERNNKNMY 481

QUERY       506 IVTYSKTAGSAGTGGVKTNTYTYRFFLGF 534
JCSG3248701 482 IVTYSKTAGSAGTGGVKTNTYTYRFFLGF 510

Note
Homologous search is done using BLAST from NCBI BLAST against database pdbnr with expect (E-value cut-off) at 0.001. The structure of a PDB sequence may be fully or partly solved. The non-redundant database pdbnr consists of unique PDB sequences from the representative PDB chains. Each representative chain has the best structural coverage in the set of the same sequences. You could click a sequence ID to see all of PDB chains associated with the sequence ID plus sequence alignments and structural coverages.



Contact Webmaster JCSG Menu