LOADING...
   ZP_02067074.1;SP17169A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02067074.1    PDB Fold Similairty





PDB sequences with significant alignments
Sequence information                                           Score	E-value
JCSG3229716|pdb|3UP6_B|hypothetical protein BACOVA_04078          675	0.0
PDB sequence alignments
QUERY       25  DVAYELPAHTTRAQLSIDLVNNGDVEQQEKINSMRFIVFGSTPGGVRLDVNEHILLSTPE 84
JCSG3229716 2   DVAYELPAHTTRAQLSIDLVNNGDVEQQEKINSMRFIVFGSTPGGVRLDVNEHILLSTPE 61

QUERY       85  TATDIDAQLLEVTSSNDILVVVIANEPQSLTSQLDGIANLLTLQEMIYDISSILNSDGQI 144
JCSG3229716 62  TATDIDAQLLEVTSSNDILVVVIANEPQSLTSQLDGIANLLTLQEMIYDISSILNSDGQI 121

QUERY       145 ISATGMPMTGVIRDISIAPDETKTVQMVIERAVARVDVFIEAIDGGAVTGYTAGSTSVTL 204
JCSG3229716 122 ISATGMPMTGVIRDISIAPDETKTVQMVIERAVARVDVFIEAIDGGAVTGYTAGSTSVTL 181

QUERY       205 HNFSHDSYFVMGNVGNGTRDNADSSKNYGKVKEDVSESNLLTHSWTAATTETWAYSSAPG 264
JCSG3229716 182 HNFSHDSYFVMGNVGNGTRDNADSSKNYGKVKEDVSESNLLTHSWTAATTETWAYSSAPG 241

QUERY       265 AENRKLLCSFYTAERLFKSDYSDRLSISMANVLKGPSDVTGITGKVIESVTKVDGTGSPT 324
JCSG3229716 242 AENRKLLCSFYTAERLFKSDYSDRLSISMANVLKGPSDVTGITGKVIESVTKVDGTGSPT 301

QUERY       325 AQPFTEIRRNNVYQVTARVGKIGIQILTISVEDWGERQDIDLDMDL 370
JCSG3229716 302 AQPFTEIRRNNVYQVTARVGKIGIQILTISVEDWGERQDIDLDMDL 347

Note
Homologous search is done using BLAST from NCBI BLAST against database pdbnr with expect (E-value cut-off) at 0.001. The structure of a PDB sequence may be fully or partly solved. The non-redundant database pdbnr consists of unique PDB sequences from the representative PDB chains. Each representative chain has the best structural coverage in the set of the same sequences. You could click a sequence ID to see all of PDB chains associated with the sequence ID plus sequence alignments and structural coverages.



Contact Webmaster JCSG Menu