LOADING...
   ZP_02066560.1;SP8524C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02066560.1    PDB Fold Similairty





PDB sequences with significant alignments
Sequence information                                           Score	E-value
JCSG3244659|pdb|4DQA_A|uncharacterized protein                    714	0.0
PDB sequence alignments
QUERY       27  NDLLEPKVYFESKEYNFSVEDEMDVMTFDLVSRLSSATSSQVDVSYSVAEPSVVDEYNAK 86
JCSG3244659 2   NDLLEPKVYFESKEYNFSVEDEMDVMTFDLVSRLSSATSSQVDVSYSVAEPSVVDEYNAK 61

QUERY       87  YGTNYEMLDVSQVKLSSTTSSISSGKLYADNIEVELSGLEALKAGNSYVLPMRVHSSSVS 146
JCSG3244659 62  YGTNYEMLDVSQVKLSSTTSSISSGKLYADNIEVELSGLEALKAGNSYVLPMRVHSSSVS 121

QUERY       147 TLSGTNIAYFFFSKPLKITKAGNFSNHYISVKFPVGTFFSSFTYEALINVDYFLDNNTIM 206
JCSG3244659 122 TLSGTNIAYFFFSKPLKITKAGNFSNHYISVKFPVGTFFSSFTYEALINVDYFLDNNTIM 181

QUERY       207 GTEGVMILRIGDAGGGITPKDYLEVAGGQNYRVTKPLLTNRWYHVALTYDQPTGKTGIYV 266
JCSG3244659 182 GTEGVMILRIGDAGGGITPKDYLEVAGGQNYRVTKPLLTNRWYHVALTYDQPTGKTGIYV 241

QUERY       267 NGEKWAGSDWGIDGFDPNSDMGFYIGRIYGFKWGERPFHGKMSEVRVWSVARTENQLKQN 326
JCSG3244659 242 NGEKWAGSDWGIDGFDPNSDMGFYIGRIYGFKWGERPFHGKMSEVRVWSVARTENQLKQN 301

QUERY       327 MLGVDPASEGLALYYKLDGSETQEGGVIKDATGRINGTTNGITIKTLDAPIAIN 380
JCSG3244659 302 MLGVDPASEGLALYYKLDGSETQEGGVIKDATGRINGTTNGITIKTLDAPIAIN 355

Note
Homologous search is done using BLAST from NCBI BLAST against database pdbnr with expect (E-value cut-off) at 0.001. The structure of a PDB sequence may be fully or partly solved. The non-redundant database pdbnr consists of unique PDB sequences from the representative PDB chains. Each representative chain has the best structural coverage in the set of the same sequences. You could click a sequence ID to see all of PDB chains associated with the sequence ID plus sequence alignments and structural coverages.



Contact Webmaster JCSG Menu