LOADING...
   ZP_02063319.1;SP13221C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02063319.1    PDB Fold Similairty





PDB sequences with significant alignments
Sequence information                                           Score	E-value
JCSG3258646|pdb|4HW6_A|hypothetical protein, IPT/TIG domain...    920	0.0
JCSG3212609|pdb|3TC9_A|Hypothetical hydrolase                     409	e-114
JCSG3155306|pdb|3KYA_A|Putative phosphatase                       218	9e-57
JCSG2998521|pdb|3HRP_A|Uncharacterized protein                    62	1e-09
PDB sequence alignments
QUERY       33  GSTLDVNQDSGTPFNPKEEIVVEKFLPTEGRKGTRVVVYGRNFGNDVSKVKVTIGGYPAK 92
JCSG3258646 1   GSTLDVNQDSGTPFNPKEEIVVEKFLPTEGRKGTRVVVYGRNFGNDVSKVKVTIGGYPAK 60
JCSG3212609 5   ------NDDAtgdFDPNKpVVISEFsPkEGglGTRMLLYGENFGSDISKIKVTIGGqdSK 58
JCSG3155306 4   ----DdNvETGA-FDPSKpVAISdFtPkEGgayqKLLIYGENFGTDVSKVKVkIGGkdAi 58
JCSG2998521 3   ----DdNKtTGAtYDPNQpVTVESFMPVEGKlreKVIVkGsNFGTDkSKVKVyFvdeaAE 58

QUERY       93  ----VINVKGESLLCICPSKAYEGD-VKVSVVGDDEAELKSGVCEAKFDYQYNYVVTTFL 147
JCSG3258646 61  ----VINVKGESLLCICPSKAYEGD-VKVSVVGDDEAELKSGVCEAKFDYQYNYVVTTFL 115
JCSG3212609 59  ----VVGAKGKSLyCVvPAKAYDGD-IKLSILNDEgeEIaNteANeKFvYQkKmLVTTFL 113
JCSG3155306 59  ----VINVKStyVyCFvPSgAFSGE-IEIT-VGEgEnaVtT-TASTtFSYEkKmVVgTLc 111
JCSG2998521 59  rlstVIGIdNNTLyCLAPrQlpgGNrIKViVdG------KEvTtDGtFkYEqaqnVSTIs 112

QUERY       148 GKL-YENNTK---WDVLAGPFD-----DCGAFDNIWRMMFDPNSNYDDLY--WVGQRDAF 196
JCSG3258646 116 GKL-YENNTK---WDVLAGPFD-----DCGAFDNIWRMMFDPNSNYDDLY--WVGQRDAF 164
JCSG3212609 114 GtM-YDGNTK---YDLkdGPFD-----DCGGFgGavwLsFDPK-NHNhLY--lVGEQhpt 161
JCSG3155306 112 G---YRNNrddqgW--rdGPFDgpegvkCcGFSDngRLaFDP-lNkDhLYicYdGHK-AI 164
JCSG2998521 113 GSaskDGNdd---gDLaSAkF--------------------------------------- 130

QUERY       197 RHVDFVNQY----VDIKTTNIGQCADVNFTLNGD---------MVVVD-DQSSDTNTGIY 242
JCSG3258646 165 RHVDFVNQY----VDIKTTNIGQCADVNFTLNGD---------MVVVD-DQSSDTNTGIY 210
JCSG3212609 162 RlIDFeKEY----VStvySGLSKvrtIcWThEADs--------MIITN-DQNNNdRpNnY 208
JCSG3155306 165 QlIDLkNRmlsspLNINTiptNRirSIaFNkKiEgyadeaeymIVAIDyDgKGDeSpSVY 224
JCSG2998521 129 ------------------------------------------------------------ 130

QUERY       243 LFTR-ASG-FTERLSLCNARGAKTC---AVHPQNGKIYYTRYHHAMI------------- 284
JCSG3258646 211 LFTR-ASG-FTERLSLCNARGAKTC---AVHPQNGKIYYTRYHHAMI------------- 252
JCSG3212609 209 ILTR-eSG-FkvitELtKGQNCNgA---eTHPiNGELYFNsWNaGQV------------- 250
JCSG3155306 225 IIkRnADGtFdDRsDIqliaAyKqCngaTIHPiNGELYFNsYEkGQVfrldlvdyfktik 284
JCSG2998521 129 ------------------------------------------------------------ 130

QUERY       285 --SSYDPAT----GTLTEEEVMMDTKGSNFHIVWHPTGDWAYIIYNGKHCIYRVDYNRET 338
JCSG3258646 253 --SSYDPAT----GTLTEEEVMMDTKGSNFHIVWHPTGDWAYIIYNGKHCIYRVDYNRET 306
JCSG3212609 251 --frYDfTT----qetTplfTIQDS-GwEFHIqFHPSGNYAYIVvvNQHyIlRsDYDwKT 303
JCSG3155306 285 ngGSWDPiVknnpNTFkQlfTIaDpSw-EFQIfiHPTGkYAYFgviNNHyFmRsDYDEik 343
JCSG2998521 129 ------------------------------------------------------------ 130

QUERY       339 GKLAVPYIVCGQHSSPGWVDGMGTGARLWGPNQGIFVKNEAYAGEEDEYDFYFCDRDSHT 398
JCSG3258646 307 GKLAVPYIVCGQHSSPGWVDGMGTGARLWGPNQGIFVKNEAYAGEEDEYDFYFCDRDSHT 366
JCSG3212609 304 kRLTTPYIVCGQQGAkdWVDGVGkkARMhAPRQGtFVKNpAYkGSSDEYDFYFCDRENHc 363
JCSG3155306 344 kEFiTPYnfvGgYKQsGYrDdVGTeARMnNPcQGVFVKNpdYTGEE-EYDFYFvDRlNfc 402
JCSG2998521 129 ------------------------------------------------------------ 130

QUERY       399 VRVLTPEGRVTTYAGRGNS------REWGYVDGELRSQALFNHPTSIAYDMKRKCFYIGD 452
JCSG3258646 367 VRVLTPEGRVTTYAGRGNS------REWGYVDGELRSQALFNHPTSIAYDMKRKCFYIGD 420
JCSG3212609 364 IRILTPQGRVTTFAGRGSN------gtsGYnDGDLRQEArFNHPeGIVYDeERECFFIGD 417
JCSG3155306 403 VRkVTPEGiVSTYAGRGaStsladgNQWGtdDGDLREvArFRdvSGLVYDdvKEmFYVhD 462
JCSG2998521 129 ------------------------------------------------------------ 130

QUERY       453 CDNHRVRKIAPEE 465
JCSG3258646 421 CDNHRVRKIAPEE 433
JCSG3212609 418 rENRRIRKIGyEE 430
JCSG3155306 463 qvGHtIRtISmEQ 475
JCSG2998521 129 ------------- 130

Note
Homologous search is done using BLAST from NCBI BLAST against database pdbnr with expect (E-value cut-off) at 0.001. The structure of a PDB sequence may be fully or partly solved. The non-redundant database pdbnr consists of unique PDB sequences from the representative PDB chains. Each representative chain has the best structural coverage in the set of the same sequences. You could click a sequence ID to see all of PDB chains associated with the sequence ID plus sequence alignments and structural coverages.



Contact Webmaster JCSG Menu