LOADING...
   ZP_02032405.1;SP13677A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02032405.1    PDB Fold Similairty





PDB sequences with significant alignments
Sequence information                                           Score	E-value
JCSG3246084|pdb|4E5V_A|Putative thua-like protein                 593	e-170
PDB sequence alignments
QUERY       25  RKPIKTLLITGQNNHNWQVSHVVLKQILENSGRFDVDFVISPEQGKDMSGFVLDFSPYQL 84
JCSG3246084 2   RKPIKTLLITGQNNHNWQVSHVVLKQILENSGRFDVDFVISPEQGKDMSGFVLDFSPYQL 61

QUERY       85  VVLDYNGDSWPEETNRRFLEYVQNGGGVVIYHAADNAFSKWPEFNRICALGGWEGRNENS 144
JCSG3246084 62  VVLDYNGDSWPEETNRRFLEYVQNGGGVVIYHAADNAFSKWPEFNRICALGGWEGRNENS 121

QUERY       145 GPYVYWKDGKLVKDSSAGPGGSHGRQHEYVLNGRDKVHPVVKGLPLKWRHAKDELYDRMR 204
JCSG3246084 122 GPYVYWKDGKLVKDSSAGPGGSHGRQHEYVLNGRDKVHPVVKGLPLKWRHAKDELYDRMR 181

QUERY       205 GPGNIRDILYTAYSDKETNGSGREEPLVFTVDYGNARIFHTMLGHAGATTEDNIAMQCTG 264
JCSG3246084 182 GPGNIRDILYTAYSDKETNGSGREEPLVFTVDYGNARIFHTMLGHAGATTEDNIAMQCTG 241

QUERY       265 FQVLLLRGAEWAATGKVTQKVPKDFPTETTCSYRKDYKEN 304
JCSG3246084 242 FQVLLLRGAEWAATGKVTQKVPKDFPTETTCSYRKDYKEN 281

Note
Homologous search is done using BLAST from NCBI BLAST against database pdbnr with expect (E-value cut-off) at 0.001. The structure of a PDB sequence may be fully or partly solved. The non-redundant database pdbnr consists of unique PDB sequences from the representative PDB chains. Each representative chain has the best structural coverage in the set of the same sequences. You could click a sequence ID to see all of PDB chains associated with the sequence ID plus sequence alignments and structural coverages.



Contact Webmaster JCSG Menu