LOADING...
   ZP_02030716.1;SP16962B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02030716.1    PDB Fold Similairty





PDB sequences with significant alignments
Sequence information                                           Score	E-value
JCSG3296872|pdb|4Q9A_A|Tat pathway signal sequence domain p...    474	e-134
JCSG3302770|pdb|4OAP_A|Acetyl xylan esterase                      110	7e-25
JCSG3293765|pdb|3W7V_A|Acetyl xylan esterase                      110	9e-25
JCSG3293803|pdb|4JKO_A|Acetyl xylan esterase                      109	2e-24
JCSG3302769|pdb|4OAO_A|Acetyl xylan esterase                      109	2e-24
JCSG3294510|pdb|4JJ4_A|Acetyl xylan esterase                      108	3e-24
JCSG3294511|pdb|4JJ6_A|Acetyl xylan esterase                      106	1e-23
JCSG3200694|pdb|3RJT_A|Lipolytic protein G-D-S-L family           86	2e-17
JCSG3186593|pdb|3P94_A|GDSL-like Lipase                           44	1e-04
PDB sequence alignments
QUERY       29  AVKENTSVHAPKINLKKDCVILFQGDSITDCGRDRNSNRCNTMEQFGSGYVLFTATQLLE 88
JCSG3296872 2   AVKENTSVHAPKINLKKDCVILFQGDSITDCGRDRNSNRCNTMEQFGSGYVLFTATQLLE 61
JCSG3302770 9   --------------------LLFiGDSITDCGRaRpEGE-GSFgaLGTGYVaYVVglLqa 47
JCSG3293765 9   --------------------LLFiGDSITDCGRaRpEGE-GSFgaLGTGYVaYVVglLqa 47
JCSG3293803 9   --------------------LLFiGDAITDCGRaRpEGE-GSFgaLGTGYVaYVVglLqa 47
JCSG3302769 9   --------------------LLFiGDSITDCGRaRpEGE-GSFgaLGTGYVaYVVglLqa 47
JCSG3294510 9   --------------------LLFiGDSITDCGRaRpEGE-GSFgaLGTGYVaYVVglLqa 47
JCSG3294511 9   --------------------LLFiGDSITDCGRaRpEGE-GSFgaLGTGYVaYVVglLqa 47
JCSG3200694 11  --------------------LVMvGDSITDCGRaHpvGEA-prggLGNGYVaLVdAHLqv 49
JCSG3186593     ------------------------------------------------------------

QUERY       89  GKAALQPKIYNRGISGNKVYQLRERWEIDCLAFQPDVLSILIGVNDYWH-----TL---- 139
JCSG3296872 62  GKAALQPKIYNRGISGNKVYQLRERWEIDCLAFQPDVLSILIGVNDYWH-----TL---- 112
JCSG3302770 48  vypeLgiRVvNKGISGNtVrDLKaRWEeDvIAqKPDwVSIMIGINDvWR-----qydlpf 102
JCSG3293765 48  vypeLgiRVvNKGISGNtVrDLKaRWEeDvIAqKPDwVSIMIGINDvWR-----qydlpf 102
JCSG3293803 48  vypeLgiRVvNKGISGNtVrDLKaRWEeDvIAqKPDwVSIMIGINDvWR-----qydlpf 102
JCSG3302769 48  vypeLgiaVvNKGISGNtVrDLKaRWEeDvIAqKPDwVSIMIGINDvWR-----qydlpf 102
JCSG3294510 48  vypeLgiRVvNKGISGNtVrDLKaRWEeDvIAqKPDwVSIMIGINDvWR-----qydlpf 102
JCSG3294511 48  vypeLgiRVvNKGISGNtVrDLKaRWEeDvIAqKPDwVSIMIGINDvWR-----qydlpf 102
JCSG3200694 50  lhpdwRiRVvNvGtSGNtVaDVaRRWEdDvMALQPDyVSLMIGVNDvWRqfdmplV---- 105
JCSG3186593 51  ----------DRGISGQtTsEMlvRFRqDvInLKPkAVvILaGINDiaH----------- 89

QUERY       140 ---THGYKGTVETYEN--DLRALLKYTKEKLPNTQIVLCEPFTLRDGAAIEDSKWYPM-- 192
JCSG3296872 113 ---THGYKGTVETYEN--DLRALLKYTKEKLPNTQIVLCEPFTLRDGAAIEDSKWYPM-- 165
JCSG3302770 103 mkekHvY---LDeYEa--tLRSLVleTKplVkG--IILmtPF------yIEgNEqdPMrr 149
JCSG3293765 103 mkekHvY---LDeYEa--tLRSLVleTKplVkG--IILmtPF------yIEgNEqdPMrr 149
JCSG3293803 103 mkekHvY---LDeYEa--tLRSLVleTKplVkG--IILmtPF------yIEgNEqdPMrr 149
JCSG3302769 103 mkekHvY---LDeYEa--tLRSLVleTKplVkG--IILmtPF------yIEgNEqdPMrr 149
JCSG3294510 103 mkekHvY---LDeYEa--tLRSLVleTKplVkG--IILmtPF------yIEgNEqdPMrr 149
JCSG3294511 103 mkekHvY---LDeYEa--tLRSLVleTKplVkG--IILmtPF------yIEgNEqdPMrr 149
JCSG3200694 106 ---VErHvG-IDeYRD--tLRhLVatTKpRV--rEMfLlSPFyL------EpNRsdPMrk 151
JCSG3186593 90  ---NNGviAleNVFgNlvSMaeLaKaNhiKVifcSVLpAydFpwRpGmqpaDK------- 139

QUERY       193 -FDEFRKSARKLSEEFNTIFVPFQSGFDAAVK-LAPARY-WSNDGVHPDLPGRQLMANMW 249
JCSG3296872 166 -FDEFRKSARKLSEEFNTIFVPFQSGFDAAVK-LAPARY-WSNDGVHPDLPGRQLMANMW 222
JCSG3302770 150 tMDQYgRvVKQIAEEtNSLFVdtQAAFNeVLK-tlypaa-lAiDrVHPSVaGHMILARaF 207
JCSG3293765 150 tMDQYgRvVKQIAEEtNSLFVdtQAAFNeVLK-tlypaa-lAwDrVHPSVaGHMILARaF 207
JCSG3293803 150 tMDQYgRvVKQIAEEtNSLFVdtQAAFNeVLK-tlypaa-lAwDrVHPSVaGHMILARaF 207
JCSG3302769 150 tMDQYgRvVKQIAEEtNSLFVdtQAAFNeVLK-tlypaa-lAwDrVHPSVaGHMILARaF 207
JCSG3294510 150 tMDQYgRvVKQIAEEtNSLFVdtQAAFNeVLKtLyPAalaWAR--VHPSVaGHMILARaF 207
JCSG3294511 150 tMDQYgRvVKQIAEEtNSLFVdtQAAFNeVLK-tlypaa-lAwDrVaPSVaGHMILARaF 207
JCSG3200694 152 tvDaYiEAmRdVAaSeHVpFVdvQAeFDrlLa-hlnTwv-lApDrVHPyLnGHlVIARaF 209
JCSG3186593 140 -viQLNKwiKEyADKnGltYVdYHSAMkderN-glPANl--SKDGVHPtLeGyKIMeKIv 195

QUERY       250 MEATGLK 256
JCSG3296872 223 MEATGLK 229
JCSG3302770 208 LReiGFE 214
JCSG3293765 208 LReiGFE 214
JCSG3293803 208 LReiGFE 214
JCSG3302769 208 LReiGFE 214
JCSG3294510 208 LReiGFE 214
JCSG3294511 208 LReiGFE 214
JCSG3200694 210 LtAVGV- 215
JCSG3186593 196 LEA---- 198

Note
Homologous search is done using BLAST from NCBI BLAST against database pdbnr with expect (E-value cut-off) at 0.001. The structure of a PDB sequence may be fully or partly solved. The non-redundant database pdbnr consists of unique PDB sequences from the representative PDB chains. Each representative chain has the best structural coverage in the set of the same sequences. You could click a sequence ID to see all of PDB chains associated with the sequence ID plus sequence alignments and structural coverages.



Contact Webmaster JCSG Menu