LOADING...
   ZP_02030627.1;SP0437A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02030627.1    PDB Fold Similairty





PDB sequences with significant alignments
Sequence information                                           Score	E-value
JCSG3286370|pdb|4MXN_B|Uncharacterized protein                    454	e-128
JCSG3154156|pdb|3JUR_D|Exo-poly-alpha-D-galacturonosidase         66	2e-11
JCSG1563009|pdb|2UVE_A|EXOPOLYGALACTURONASE                       53	2e-07
JCSG211710|pdb|1BHE_A|POLYGALACTURONASE                           49	2e-06
PDB sequence alignments
QUERY       23  KDYQVAMFGIKSDGVTLNTRSIQRAVDYISEQGGGRLIF-YVGRYLTGSIELKSNVTIRI 81
JCSG3286370 20  KDYQVAMFGIKSDGVTLNTRSIQRAVDYISEQGGGRLIF-YVGRYLTGSIELKSNVTIRI 78
JCSG3154156 33  -------FGaRGDGrTdcSESFKRAIEeLSKQGGGRLIv-peGvFLTGpIHLKSNIeLHV 84
JCSG1563009 162 -------FGaiDDGkTLNTKAIQQAID--ScKpGcRVeI-pAGtYkSGALwLKSDMTLNL 211
JCSG211710  18  ---------LKADSsTa-TsTIQKALNncDQgkAvRLsagsTSvFLSGpLSLpSGVSLlI 67

QUERY       82  EEGAVLVAVPSVY------DF-------------KGVGGCN--AIIYADKQ----KNIGI 116
JCSG3286370 79  EEGAVLVAVPSVY------DF-------------KGVGGCN--AIIYADKQ----KNIGI 113
JCSG3154156 85  KgtikFIpdPErYlpvvltrF-------------EGIelyNyspLVYAldc----ENVAI 127
JCSG1563009 212 QaGAILLGseNpd------DYpagyrlypystieRpASliN--AIdpnNSKpgtfRNIrI 263
JCSG211710  68  DKGVTLrAVnNAk------SFenapsscgvvd--KNgkGCD--AFItAvSt----tNsGI 113

QUERY       117 GGKGIID----------------GRSI-----AVRASVEE----Q--LQKGHIEGNVSD- 148
JCSG3286370 114 GGKGIID----------------GRSI-----AVRASVEE----Q--LQKGHIEGNVSD- 145
JCSG3154156 128 tGSGVLD----------------G------------------------------------ 135
JCSG1563009 264 tGSGVIDgngwlraktaeitdelGRSLpqyvaSkNSKVHE----DgiLaKNQVEkaVSDg 319
JCSG211710  114 yGpGtID----------------GQG------GVKlQdKKvswwE--LaadakvkKLKQ- 148

QUERY       149 ---------YAPALICMEGCEDVKIEQVTLQDAANVAEIYKDCHNVTVDKVVVNA-GASD 198
JCSG3286370 146 ---------YAPALICMEGCEDVKIEQVTLQDAANVAEIYKDCHNVTVDKVVVNA-GASD 195
JCSG3154156 134 ------------------------------------------------------------ 135
JCSG1563009 320 mdlknaygqrrsSLMtLRGvENVyLagfTVRNpAfhGiMnlEnHNVVANgLIhQTydANN 379
JCSG211710  149 ---------nTPrLIqINksKNftLyNVSLiNSpNfhvVFSDgdGfTAwKTTIKT-pSTa 198

QUERY       199 RKAISISGCDGVKMTDCYFNMAGNPLE-SAGTSRNLIFTNCITPDGKAVSSDQ 250
JCSG3286370 196 RKAISISGCDGVKMTDCYFNMAGNPLE-SAGTSRNLIFTNCITPDGKAVSSDQ 247
JCSG3154156 134 ----------------------------------------------------- 135
JCSG1563009 380 gdGIEFGNsQNVmVfNnFFDtGdDcINfAAGT--------------------- 411
JCSG211710  199 RNTdGIDpmSSkNITiAYsNIA------------------------------- 220

Note
Homologous search is done using BLAST from NCBI BLAST against database pdbnr with expect (E-value cut-off) at 0.001. The structure of a PDB sequence may be fully or partly solved. The non-redundant database pdbnr consists of unique PDB sequences from the representative PDB chains. Each representative chain has the best structural coverage in the set of the same sequences. You could click a sequence ID to see all of PDB chains associated with the sequence ID plus sequence alignments and structural coverages.



Contact Webmaster JCSG Menu