LOADING...
   YP_193882.1;GD9765C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_193882.1    PDB Fold Similairty





PDB sequences with significant alignments
Sequence information                                           Score	E-value
JCSG2878989|pdb|2MWM_A|Putative trp repressor binding protein     308	9e-85
JCSG3160243|pdb|3KLB_A|Putative Flavoprotein                      47	5e-06
JCSG3259242|pdb|4ICI_A|Putative flavoprotein                      42	2e-04
PDB sequence alignments
QUERY       1   MAKKTLILYYSWSGETKKMAEKINSEIKDSELKEVKVSEG--TFDADMYKTSDIALDQIQ 58
JCSG2878989 2   MAKKTLILYYSWSGETKKMAEKINSEIKDSELKEVKVSEG--TFDADMYKTSDIALDQIQ 59
JCSG3160243 5   --RKiLVaYFScSGvTKaVAEKL-AaItgADLyEIKpEvp--ytEADLdwNDkkSrSSVE 59
JCSG3259242 15  ---KiLVaYFSaTGtTaRaAEKLGAaV-gGDLypIapAQp--ytSADLdwNNkrSrSSVE 68

QUERY       59  GN--KDF--PEIQLDNIDYNNYDLILIGSPVWSGYPATPIKTLLDQMKNYRGEVASFFTS 114
JCSG2878989 60  GN--KDF--PEIQLDNIDYNNYDLILIGSPVWSGYPATPIKTLLDQMKNYRGEVASFFTS 115
JCSG3160243 60  mR--daLsrPaISgtlFhpEKYEVLFVGfPVWwyiapTiINTFLESydfagkiVVpFaTS 117
JCSG3259242 69  mNdpKmr--PaIKskKeNiGTYDVVFIGyPIWwdlapriINTFIEghSlkgktVVpFaTS 126

QUERY       115 AGTN--------HKAYVSHFN--EWADGLNVIG-VARDDSEVDKWSK 150
JCSG2878989 116 AGTN--------HKAYVSHFN--EWADGLNVIG-VARDDSEVDKWSK 151
JCSG3160243 118 GGSGignceknlHKAYpDiv----WkDGklLnGqITRD--------- 151
JCSG3259242 127 GGSS------------------------------------------- 130

Note
Homologous search is done using BLAST from NCBI BLAST against database pdbnr with expect (E-value cut-off) at 0.001. The structure of a PDB sequence may be fully or partly solved. The non-redundant database pdbnr consists of unique PDB sequences from the representative PDB chains. Each representative chain has the best structural coverage in the set of the same sequences. You could click a sequence ID to see all of PDB chains associated with the sequence ID plus sequence alignments and structural coverages.



Contact Webmaster JCSG Menu