LOADING...
   YP_095136.1;SP19086A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_095136.1    PDB Fold Similairty





PDB sequences with significant alignments
Sequence information                                           Score	E-value
JCSG3249033|pdb|4EZI_A|Uncharacterized protein                    768	0.0
JCSG2999286|pdb|3H2H_A|esterase                                   96	4e-20
JCSG2999287|pdb|3H2I_A|esterase                                   94	2e-19
JCSG2999285|pdb|3H2K_A|esterase                                   94	2e-19
PDB sequence alignments
QUERY       28  ALEHEKLVNYIALGEFSRETAEIALKKMPPLDTLTVHYDLQLYKINYKTQSPDGNLTIAS 87
JCSG3249033 2   ALEHEKLVNYIALGEFSRETAEIALKKMPPLDTLTVHYDLQLYKINYKTQSPDGNLTIAS 61
JCSG2999286 43  --------------------------------------NVRVaEFTYaTiGvEGEpAtAS 64
JCSG2999287 43  --------------------------------------NVRVaEFTYaTiGvEGEpAtAS 64
JCSG2999285 43  --------------------------------------NVRVaEFTYaTiGvEGEpAtAS 64

QUERY       88  GLVAMP--IHPVGQVGIISYQHGTRFERNDVPSRN--NEKNYIYLAAYGNSAGYMTVMPD 143
JCSG3249033 62  GLVAMP--IHPVGQVGIISYQHGTRFERNDVPSRN--NEKNYIYLAAYGNSAGYMTVMPD 117
JCSG2999286 65  GVLlIPggeRcsGpypLLGWgHpTEalRaQeqAKEirDaKGddpLVTrlaSqGYVVVgsD 124
JCSG2999287 65  GVLlIPggeRcsGpypLLGWgHpTEalRaQeqAKEirDaKGddpLVTrlaSqGYVVVgsD 124
JCSG2999285 65  GVLlIPggeRcsGpypLLGWgHpTEalRaQeqAKEirDaKGddpLVTrlaSqGYVVVgsD 124

QUERY       144 YLGLGDNELTLHPYVQAETLASSSIDMLFAAKELANRLHYPISDKLYLAGYSEGGFSTI- 202
JCSG3249033 118 YLGLGDNELTLHPYVQAETLASSSIDMLFAAKELANRLHYPISDKLYLAGYSEGGFSTI- 176
JCSG2999286 125 YLGLGkSNyAyHPYLHSaSeASATIDaMrAARSVlQHLktPLSgKVmLSGYSQGGhTAMa 184
JCSG2999287 125 YLGLGkSNyAyHPYLHSaSeASATIDaMrAARSVlQHLktPLSgKVmLSGYSQGGhTAMa 184
JCSG2999285 125 YLGLGkSNyAyHPYLHSaSeASATIDaMrAARSVlQHLktPLSgKVmLSGYSQGGhTAMa 184

QUERY       203 VMFEMLAKEYPDLPVSAVAPGSAPYGWEETMHFVMLEPGPRATA-------YL------- 248
JCSG3249033 177 VMFEMLAKEYPDLPVSAVAPGSAPYGWEETMHFVMLEPGPRATA-------YL------- 222
JCSG2999286 185 TQrEIeAhlskEFhLvAsAPiSGPYAlEQT--FLdswsGsNAVG-------en------- 228
JCSG2999287 185 TQrEIeAhlskEFhLvAsAPiSGPYAlEQT--FLdswsGsNAVG-------ewtfgillg 235
JCSG2999285 185 TQrEIeAhlskEFhLvAsAPiSGPYAlEQT--FLdswsGsNAVGentfgillg------- 235

QUERY       249 AYFF----YSL----Q-TYKSYWSGFDEIFAPPYNTLIPELMDGYHAVDEIL--QALPQD 297
JCSG3249033 223 AYFF----YSL----Q-TYKSYWSGFDEIFAPPYNTLIPELMDGYHAVDEIL--QALPQD 271
JCSG2999286 229 TFFIllgsYAIvamqH-TYKNiYlepgQVFqdPWaAkVepLFpGkQSLtDMFlnDTLPSi 287
JCSG2999287 236 SYaI----vAM----QhTYKNiYlepgQVFqdPWaAkVepLFpGkQSLtDMFlnDTLPSi 287
JCSG2999285 236 SYaI----vAM----QhTYKNiYlepgQVFqdPWaAkVepLFpGkQSLtDMFlnDTLPSi 287

QUERY       298 PLL--IFQPKFSNGIISKTDRNTEILKINFNHYDFKPTAPLLLVGTKGDRDVPYAGAEMA 355
JCSG3249033 272 PLL--IFQPKFSNGIISKTDRNTEILKINFNHYDFKPTAPLLLVGTKGDRDVPYAGAEMA 329
JCSG2999286 288 dkVksyFQPgFySdFpSNpaNpfRqdlaRnNllEWaPqTPtLLcGSSNDatVPlkNAQtA 347
JCSG2999287 288 dkVksyFQPgFySdFpSNpaNpfRqdlaRnNllEWaPqTPtLLcGSSNDatVPlkNAQtA 347
JCSG2999285 288 dkVksyFQPgFySdFpSNpaNpfRqdlaRnNllEWaPqTPtLLcGSSNDatVPlkNAQtA 347

QUERY       356 YHSFRKYSDFVWIKSVSDALDHVQAHPFVLKEQVDFFKQFERQEAMNK 403
JCSG3249033 330 YHSFRKYSDFVWIKSVSDALDHVQAHPFVLKEQVDFFKQFERQEAMNK 377
JCSG2999286 348 iaSFQQ------------------------------------------ 353
JCSG2999287 348 iaSFQQ------------------------------------------ 353
JCSG2999285 348 iaSFQQ------------------------------------------ 353

Note
Homologous search is done using BLAST from NCBI BLAST against database pdbnr with expect (E-value cut-off) at 0.001. The structure of a PDB sequence may be fully or partly solved. The non-redundant database pdbnr consists of unique PDB sequences from the representative PDB chains. Each representative chain has the best structural coverage in the set of the same sequences. You could click a sequence ID to see all of PDB chains associated with the sequence ID plus sequence alignments and structural coverages.



Contact Webmaster JCSG Menu