LOADING...
   YP_094990.1;SP19432A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_094990.1    PDB Fold Similairty





PDB sequences with significant alignments
Sequence information                                           Score	E-value
JCSG3281085|pdb|4KH9_A|hypothetical protein                       744	0.0
PDB sequence alignments
QUERY       20  FTLPRQPTKAYECENCSQLSRENLHDKWEITNEPLNNNISNVRRSYGYKERISLEQLQRG 79
JCSG3281085 2   FTLPRQPTKAYECENCSQLSRENLHDKWEITNEPLNNNISNVRRSYGYKERISLEQLQRG 61

QUERY       80  VIISTLAPGAVVRITPLQNKSIPELLIKTPKNQLLPLKEASSLYNQDDEVGNNPLAITKH 139
JCSG3281085 62  VIISTLAPGAVVRITPLQNKSIPELLIKTPKNQLLPLKEASSLYNQDDEVGNNPLAITKH 121

QUERY       140 QAMLQIKPELGYGKFILKSKDITNKYADAYMISVLDKFSITYLEVETDSLHYQYGDKLKA 199
JCSG3281085 122 QAMLQIKPELGYGKFILKSKDITNKYADAYMISVLDKFSITYLEVETDSLHYQYGDKLKA 181

QUERY       200 TISLHNDITEYDVNDVDARLVGPKGQVISLNLTKLKSNVFEGTATLDSELNDRGENWYLE 259
JCSG3281085 182 TISLHNDITEYDVNDVDARLVGPKGQVISLNLTKLKSNVFEGTATLDSELNDRGENWYLE 241

QUERY       260 TDVQTEYGQEIIRRSGHTAFSYSIPSASLMNVKKLSSKPLTFVVTVDVATASRYALQSVL 319
JCSG3281085 242 TDVQTEYGQEIIRRSGHTAFSYSIPSASLMNVKKLSSKPLTFVVTVDVATASRYALQSVL 301

QUERY       320 FQKNGKGEARPIQTSQRAQWLEPGKHVLQFTFDNHNQLSDDNLYLGYLRLIDYGQLKTVY 379
JCSG3281085 302 FQKNGKGEARPIQTSQRAQWLEPGKHVLQFTFDNHNQLSDDNLYLGYLRLIDYGQLKTVY 361

QUERY       380 QYNQPVKLSQLVD 392
JCSG3281085 362 QYNQPVKLSQLVD 374

Note
Homologous search is done using BLAST from NCBI BLAST against database pdbnr with expect (E-value cut-off) at 0.001. The structure of a PDB sequence may be fully or partly solved. The non-redundant database pdbnr consists of unique PDB sequences from the representative PDB chains. Each representative chain has the best structural coverage in the set of the same sequences. You could click a sequence ID to see all of PDB chains associated with the sequence ID plus sequence alignments and structural coverages.



Contact Webmaster JCSG Menu