LOADING...
   YP_001305260.1;PX14343H
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001305260.1    PDB Fold Similairty





PDB sequences with significant alignments
Sequence information                                           Score	E-value
JCSG3186572|pdb|3OTN_A|SusD superfamily protein                   975	0.0
JCSG2998868|pdb|3IHV_A|SusD homolog                               100	2e-21
JCSG3196065|pdb|3QNK_D|Putative lipoprotein                       98	1e-20
JCSG2998305|pdb|3I4G_A|SusD-like carbohydrate binding prote...    86	4e-17
JCSG3000088|pdb|3IV0_A|SusD homolog                               85	1e-16
JCSG3292365|pdb|4L7T_A|NanU sialic acid binding protein           81	1e-15
JCSG3085978|pdb|3JYS_A|SusD superfamily protein                   80	2e-15
JCSG3166070|pdb|3MCX_A|SusD superfamily protein                   80	3e-15
JCSG3087283|pdb|3KEZ_A|Putative sugar binding protein             72	9e-13
JCSG3000363|pdb|3JQ1_B|SusD superfamily protein                   69	1e-11
JCSG3000362|pdb|3JQ0_A|SusD superfamily protein                   65	8e-11
JCSG3166777|pdb|3MYV_A|SusD superfamily protein                   59	8e-09
JCSG3159245|pdb|3L22_A|SusD superfamily protein                   57	2e-08
JCSG1675776|pdb|3CK9_B|SusD                                       51	2e-06
JCSG3186228|pdb|3NQP_B|SusD superfamily protein                   49	8e-06
JCSG3210607|pdb|3SNX_A|PUTATIVE SUSD-LIKE CARBOHYDRATE BIND...    46	7e-05
PDB sequence alignments
QUERY       23  LDEQPTGTMTTDSKLTSKESALALTNSAY---LKNTVFNKMTPGWGCNTILLLEYMTGKA 79
JCSG3186572 2   ---QPTGTMTTDSKLTSKESALALTNSAY---LKNTVFNKMTPGWGCNTILLLEYMTGKA 55
JCSG2998868     ------------------------------------------------------------
JCSG3196065     ------------------------------------------------------------
JCSG2998305 4   LERyPltdLSeETfwNSESNAelalTSlYrgsLtDgVeyNpSdwWSyHgMIMMEHLSdNA 63
JCSG3000088     ------------------------------------------------------------
JCSG3292365     ------------------------------------------------------------
JCSG3085978     ------------------------------------------------------------
JCSG3166070     ------------------------------------------------------------
JCSG3087283     ------------------------------------------------------------
JCSG3000363     ------------------------------------------------------------
JCSG3000362     ------------------------------------------------------------
JCSG3166777     ------------------------------------------------------------
JCSG3159245     ------------------------------------------------------------
JCSG1675776     ------------------------------------------------------------
JCSG3186228     ------------------------------------------------------------
JCSG3210607     ------------------------------------------------------------

QUERY       80  TSENSQSN--YKD--------FQDLLVSDRSLYIEDWWQDCYAGIANCNLALQ----KL- 124
JCSG3186572 56  TSENSQSN--YKD--------FQDLLVSDRSLYIEDWWQDCYAGIANCNLALQ----KL- 100
JCSG2998868 77  ---------------------------------VQQtWaalYTGIyRANdfLErisnKI- 102
JCSG3196065 43  -SDNSvSa--qRDkyraswfkFNydMVSasDpqdDDvWEDyYVkVrKCNrfFE----RI- 94
JCSG2998305 64  fDRRGENNpfFKi--------sSgnLTADNA-FIKrYWEtsYkrIGyCNrfL------V- 107
JCSG3000088 92  -------------------------------------WDvfYTAIqDANIlLa----EI- 109
JCSG3292365 100 -----------------------------------------YkvInQiNLmIa----Kt- 113
JCSG3085978 85  ---------------------------------IEgvYQrCmyiVAlvNefLK----NI- 106
JCSG3166070 75  -----------------------NVLASD-NLnIvlpWNtvYkvIrQtNnlIQ----KIe 106
JCSG3087283 82  -------------------------------------WSylYSiIqNCNLiLM----NV- 99
JCSG3000363 80  -----------------------------------------YnALyRtNsiMQ----KL- 93
JCSG3000362 74  ---------------------------------------DmYkiInQiNqmIa----Kt- 89
JCSG3166777 0   ------------------------------------------------------------
JCSG3159245 83  -----------------------------------DtWtyAYlAInKvNtfLQ----SL- 102
JCSG1675776     ------------------------------------------------------------
JCSG3186228 87  ---------------------------------------DlFGrITNlNLfIa----RV- 102
JCSG3210607 79  -------------------------------------WyliYktIdNCNtAIS----ik- 96

QUERY       125 -GEF--ENLDASLVNGYMAEVKFMRALYYFYLVRIF----------G-------DV---- 160
JCSG3186572 101 -GEF--ENLDASLVNGYMAEVKFMRALYYFYLVRIF----------G-------DV---- 136
JCSG2998868 103 -GSY--tTtDkKLATlYIAEARaLRGMFYFeLVRrF----------G-------NV---- 138
JCSG3196065 95  -Gt---STIEeSekSrltGEVhFLRAMFYFeMVKrY----------G-------gV---- 129
JCSG2998305 108 -Giq--NSsESEkkTrmIAEARFLRAtqYFYLAsyF----------k-------NV---- 143
JCSG3000088 110 -dKv--pGMDelkrSrFkAEAiFMRSLsYFFIVRaF----------G-------DV---- 145
JCSG3292365 114 -kEt--tvLSeAgkNyYLGEAygMRAylYFHLLRsW----------G-------DVilyl 153
JCSG3085978 107 -pNap-ESIDkE---SYIAQARFnRAFaYYvLMdMF----------A-------lp---- 140
JCSG3166070 107 sGSI--QSsDTKeLNrikSEAlvMRGLslFnLTRLF----------G--------M---- 142
JCSG3087283 100 -dKLsiDEdETEykNdlkGQAlaIRGMalFdLTRIF----------G--------y---- 136
JCSG3000363 94  -eEkk-EQFSTDFqNSvkGEclFIRGFYlFqLAKeF----------k-------DA---- 130
JCSG3000362 90  -tEt--tiLteAtqNyYLGEAygMRAylYFHLLRsW----------G-------DV---- 125
JCSG3166777 96  -GKI--ESgDeKkLNAlkGETmaViALcqFdLTRcF----------G--------y---- 130
JCSG3159245 103 -ega--REVaGEnyDrYVqEAKFVRALaYYYLnNLYptpysvnpdak-------SV---- 148
JCSG1675776 129 ------------------AEIRFLRALHYWYFLdLF----------G-------kA---- 149
JCSG3186228 103 -tDa--tyLSdEMkNfYLGEVygLRAFYYFdLyRIY----------G-------gV---- 138
JCSG3210607 97  -GDs--EELrqA-----QGQAlaLRAFcYLHLVQhY----------qftylkdkDA---- 134

QUERY       161 P---KITTVQ--S-E--------LG----------ELQVS----------RAPVK---EI 183
JCSG3186572 137 P---KITTVQ--S-E--------LG----------ELQVS----------RAPVK---EI 159
JCSG2998868 139 v---lMTSTQmsN-Q--------np----------atyVQ----------sAPeKvyeyI 166
JCSG3196065 130 i---lLdkVl--T-m--------ed----------NwEIp----------RSseK---Ec 152
JCSG2998305 144 P---lVeNVl--T-g--------ee----------anNVT----------KTsqa---DI 166
JCSG3000088 146 P---yyTNAy--N-EaplprtnmVi----------vLQnc----------lAdLQ---pL 176
JCSG3292365 154 d---ytNgAS--l-D--------LS----------NLSkA----------aSPAE---EV 176
JCSG3085978 141 P---fITekN--y-S--------Ie----------papLS----------R-------Ed 159
JCSG3166070 143 P---ytNdkg--A-S--------LGvpietspsdpthKpS----------RStVa---Qc 175
JCSG3087283 137 P---yLkdng--A-S--------LGvpivkelstiDsKpA----------RntVa---Ec 169
JCSG3000363 131 P---lrlTAS--Q-S--------pS----------tFpLA----------KSsqa---DI 153
JCSG3000362 126 vlyldyTegQ--NlD--------LS----------NItkG----------vSPAt---EV 152
JCSG3166777 131 P---ytkdkg--A-S--------LG----------aplIDhlvgtyenppRStVa---Qa 163
JCSG3159245 149 P---lrlTAE--A-g--------te----------NnNMp----------RStVK---QI 171
JCSG1675776 150 P---fkehfS--N-D--------Lp----------veKkG----------telyt---yI 172
JCSG3186228 139 P---lrlTAD--v-v--------eGvidpn-----KLyMA----------RStpK---EV 166
JCSG3210607 135 Pcv-pIyTep--T-t--------sG----------tkpkG----------KStVa---QV 159

QUERY       184 YDEI--IIP-DLLEAEQ---SDLAF--S-DHTG-----RV--------------SMGAVK 215
JCSG3186572 160 YDEI--IIP-DLLEAEQ---SDLAF--S-DHTG-----RV--------------SMGAVK 191
JCSG2998868 167 eDDL--LyacDILpyat---DDqyr--E-SNdy-----Rf--------------SkGAAl 199
JCSG3196065 153 YD-F--ILe-DLkKAtE---mlpAsygS-rEkG-----RA--------------TkGAAy 185
JCSG2998305 167 lkwc--Vte---FtAaa---ADL------pRfS-----aI--------------paGeAg 193
JCSG3000088 177 lDDd--pga-EVLpwSy---S--SY--S-Skgi-----RA--------------SrGSVi 206
JCSG3292365 177 mkQ---Ike-DItaSEKgfgSDySF--K-ygry-----yw--------------SMAATQ 210
JCSG3085978 160 lfNw--Iea-ELnEiKp---NlpSp--r-SEyG-----vA--------------DQAVAS 191
JCSG3166070 176 YEQV--V-s-DMsNA-l---SgLrq--E-tsNG-----yI--------------NywAAQ 205
JCSG3087283 170 YtEI--I-s-DLkNStE---l-LSg--D-fNkG-----KV--------------NrwAAm 199
JCSG3000363 154 WaQa----k-EdLKTaa---SlLpI--T-NkiG-----Kp--------------TQGAAy 183
JCSG3000362 153 mEQ---Ikk-DIqaSENafgSDySF--K-lgrh-----fw--------------SaAATQ 186
JCSG3166777 164 YDfI--I---EtLEeav---TlMSe--E-kNNG-----RM--------------NkyAAR 193
JCSG3159245 172 Y-Eh--ILs-DLeNiSa---lDtev--N-tYTGvt---HA--------------TQAAAN 204
JCSG1675776 173 qNELneIea-DMyEpRQ---ApF---------G-----RA--------------DkAAnw 200
JCSG3186228 167 mtQI------------K---SDLnk--SmEYfG-----NMndfdpykrgkkvywSkAATE 204
JCSG3210607 160 YQQI--F---DdLNlaQ---DyLTn--y-vRkGdgqkfKp--------------NtdVVN 194

QUERY       216 ALLADVYLTYAGY--PLQGGKSYYAE--SAKRSLEVI--------------------KSN 251
JCSG3186572 192 ALLADVYLTYAGY--PLQGGKSYYAE--SAKRSLEVI--------------------KSN 227
JCSG2998868 200 GLLTkVYaTWAGY--PVK-dESkWea--AAKtAriLV--------------------ESG 234
JCSG3196065 186 ALkSrVeLydkrY----EdviKscAE--vyKlGyELV----------------------- 216
JCSG2998305 194 rackQAaLAFlGr--tcMlqKD-WkS--GAKafhDIM--------------------ElG 228
JCSG3000088 207 ALMmhInLwlVqF--daQNkEQYYrN--vVSlGeELe--------------------RNN 242
JCSG3292365 211 mLkGEVYL-WSGr--qMgGGtAdYT---TAKtALQsI--------------------vSN 244
JCSG3085978 192 ALLArMYLNaeiY--t---GKArYTE--ciNacnEVI--------------------KAG 224
JCSG3166070 206 ALLSrVYLNmGeY--q----KAYdAa--T-----DVI--------------------KNN 232
JCSG3087283 200 TLLSrVYLy-----------KGeYnE--AltmAeNAI--------------------KGa 226
JCSG3000363 184 AaLGkIYVyeeNW------------Q--EAiNvLEpL--------------------tQN 209
JCSG3000362 187 mLkGEAYL-WSGr--qMNGGNSdYT---iAKNAFEnV--------------------KKa 220
JCSG3166777 194 ALLArIYLyH-------DdNRKaFdl--AdQlikDAd--------------------tSG 224
JCSG3159245 205 mLkmrVYMAmneWdkaItAGElvtGy--SlpEDVtLI--------------------yKa 242
JCSG1675776 201 lLrArLYLNaGvY--t---GQTdYAK--AeEyAsKVI--------------------gS- 232
JCSG3186228 205 CLMGEVYLwtSkv--ttgddvAnpADltiAKthLEsVlnnynlkmlddfsqvfnaknKAN 262
JCSG3210607 195 GLMArAYLltGqW-----GeaAkaAE--AARKGySLM----------------------- 224

QUERY       252 --E---YT--LFTDYESL----RL----PSQN---NK--G-EFIYQV------------- 277
JCSG3186572 228 --E---YT--LFTDYESL----RL----PSQN---NK--G-EFIYQV------------- 253
JCSG2998868 235 --K---Hg--LLkDYEQL----wk----nTcNgtwDp--t-EsLiEI------------- 263
JCSG3196065 217 --D---gT--tpekYRSI----ww----tTNK---DN--k-EIIFDV------------- 242
JCSG2998305 229 --D---nA--InANYQEL----fy----PStG---TS--NkEnIFyI------------- 255
JCSG3000088 243 --g---ay--sLlDiNrs----sV----ifaG---GS--d-EgLFEI------------- 268
JCSG3292365 245 a-N---vS--LqdDFSKV----fa----yNNK---DN--S-EIIFSI------------- 271
JCSG3085978 225 ------Yq--LadNYaDLfkadNg----eNpD---TK--k-EIIYpI------------- 253
JCSG3166070 233 ggR---Yq--LYSyeEyp----NV----wGQD---fQ--S-EsLFEL------------- 260
JCSG3087283 227 --EkegYA--LWTNeEyp----tawgndaSaS---Np--G-EILFEI------------- 259
JCSG3000363 210 --p---YTykLveDFNwn----fd----dTHE---NN--A-EsIFEL------------- 237
JCSG3000362 221 --D---vg--LvTSsfKd----iF----sfEN---KK--NkEMIFtIhngkdeyemwggy 260
JCSG3166777 225 --S---YA--LYpheKyV----aa----wSvE---aKfgS-EsFFEI------------- 252
JCSG3159245 243 --p---Y----FSQeSiF----sL----PmaD---TN------IpNT------------- 263
JCSG1675776 233 --a---Yk--LcTNYSEL----fMadndeNEN---am--q-EIIlpI------------- 262
JCSG3186228 263 --D---ei--IFA-iRfL----Eg----eAtN---SN--G-tFtYNVg------------ 288
JCSG3210607 225 -------T--ttAEYEGF----N------NiS---NK----EWIWgs------------- 245

QUERY       278 -Q---------F---SLNKRHNESVRI---FLP----------S----RS-GI------- 299
JCSG3186572 254 -Q---------F---SLNKRHNESVRI---FLP----------S----RS-GI------- 275
JCSG2998868 264 -S---------FyspTVSgNsDpvgRI---gkw----------N----gv-kt------- 288
JCSG3196065 243 -Q---------Y---KspdvYNNmMvc---nMv----------T----yi-Nd------- 264
JCSG2998305 256 -Q---------Y---leN-----yLgt---gLP----------Q----HA--L------- 271
JCSG3000088 269 -aqninfnei-F---mMNaKfSDNVsy---scl----------N----KSmpL------- 299
JCSG3292365 272 -R---------n---AkDEyNmwDdRFrqnLVPqqaymtstycN----KE-GV------- 306
JCSG3085978 254 -i---------F---DgDKtQSwGMaa---IIi----------G----ar-Gaedkdvll 282
JCSG3166070 261 -y---------I---TLSEpsGgTgge---gaP----------m----vy-An------- 282
JCSG3087283 260 -v---------n---ltTdspGKEsmg---YLn----------S----yN-G-------- 280
JCSG3000363 238 -liedvggtdlW---GdGENiNSTqsn---trP----------K----Ey-Aa------- 268
JCSG3000362 261 yR---------M---rLipaQDKmVKI---Ycden--------G----NS-fV------- 285
JCSG3166777 253 -a---------n---SVDdtpGRDswg---YL--------------------L------- 269
JCSG3159245 264 -Q---------q---SLaEyYyDGkiM---LId----------T----KS-GI------- 285
JCSG1675776 263 -R---------q---DgvKtRNyGgst---YLv----------c----gT-rV------- 284
JCSG3186228 289 -t---------g---StKNRYQaNgEV---Fgd----------AldiqNT-Gn------- 314
JCSG3210607 246 -p---------q---TLSQs-DaSyNF---Yyl----------D----aT-yV------- 266

QUERY       300 --SAY------------------------DLEYGSL-------IP-----------TKEF 315
JCSG3186572 276 --SAY------------------------DLEYGSL-------IP-----------TKEF 291
JCSG2998868 289 --TAi------------------------agvrGSc-------aa-----------NvKv 304
JCSG3196065 265 --Kyg------------------------DrgWGGL-------gP-----------TQEL 280
JCSG2998305 272 --SAk------------------------DggWSlV-------nP-----------AaDL 287
JCSG3000088 300 --fCY------------------------SgDY--L-------Mt-----------lfpM 313
JCSG3292365 307 --Sfk------------------------DLpeGQLnglirlqIr-----------ydlY 329
JCSG3085978 283 ahSGv------------------------DqgWAGF-------ra-----------TSNL 300
JCSG3166070 283 --EA-------------------------tVDWNNL-------Il-----------SEDF 297
JCSG3087283 281 --------------------------------YdDM-------ci-----------TcSF 290
JCSG3000363 269 --Aev------------------------ggwYeAn--------P-----------TQQI 283
JCSG3000362 286 --GTp------------------------DaQlNGL-------tq-----------lQvr 301
JCSG3166777 270 --NwY------------------------gyQkGfV--------------------TQKY 283
JCSG3159245 286 --mSk------------------------p-DY-SL-------at-----------dKRI 299
JCSG1675776 285 --AGmprmgttngwscifaraamvqkffsNLEdvpM-------LPadveiptkgldTdEq 335
JCSG3186228 315 --QTY------------------------Ey-------------------------NKav 323
JCSG3210607 267 --GAY------------------------S----SF-------Ma-----------dpHL 278

QUERY       316 VESF--E-------KGD-------KRT---E--------E---KQY-----FFTN----- 335
JCSG3186572 292 VESF--E-------KGD-------KRT---E--------E---KQY-----FFTN----- 311
JCSG2998868 305 VHTF--vldw----ReD-------vsd---i--------R---RDl-----sIAN----- 327
JCSG3196065 281 IDAF--E-------mADgtpatqySQA---p--------a---dQv-----FdiNtcgi- 311
JCSG2998305 288 yESY--E-------fkD-------gtpfsyD--------D---pRY-----dpSNlgkdr 315
JCSG3000088 314 yEDd--a-------RkE-------lwf---D--------E---KiY-----stSv----- 333
JCSG3292365 330 nKAF--R-------dGD-------tRk---D--------a-------------------- 342
JCSG3085978 301 VHlF--DfqndeepKAS-------Eiq---D--------K---Rgi-----FYd------ 326
JCSG3166070 298 LNlL--N-------Edp-------KdV---R--------HcltKEs-----vIeN----- 320
JCSG3087283 291 yQlL--K-------Kdp-------KdV---R--------l---Kil-----sFdKk---- 311
JCSG3000363 284 MDiF--w-------Kek-------dKd---g--------N---fDYrarcsvawD----- 308
JCSG3000362 302 rEfY--f-------KGf-------RNN---D--------t---R-------WtTS----- 319
JCSG3166777 284 AEQMlaD-------pGD-------vR---------------------------------- 295
JCSG3159245 300 Iaf-----------KGE-------K----------------------------------- 306
JCSG1675776 336 IDAF--Da------Ehg-------iRT---EdmikaagdD---Ral-----LYSG----- 364
JCSG3186228 324 yQNF--D-------dAD-------tRk---E--------a---tfi-----asyN----- 343
JCSG3210607 279 MDTF--v-------KGD-------iRl---p--------l---fQW-----MreG----- 298

QUERY       336 --------------YKGHPSKF---------------SP--GAAELE--FMD-------- 354
JCSG3186572 312 --------------YKGHPSKF---------------SP--GAAELE--FMD-------- 330
JCSG2998868 328 --------------YQytdTKk---------------Sl--wVAgaS--dtD-------- 346
JCSG3196065 312 --------------YEGRepRFyanivfhgsqiffnaDk--GAVtVDryLMDtpdkgdgs 355
JCSG2998305 316 dprldytiyyngaiFmGteyKM---------------SPdySAAKkE--kLD-------- 350
JCSG3000088 334 --------------sSSaPKEI---------------K--------K--FwN-------- 346
JCSG3292365 343 -------------------------------------Sm--tAVyqK--qQD-------- 353
JCSG3085978 327 ---------------KGRsidI---------------Ts--SVSgt----FE-------- 342
JCSG3166070 321 --------------ntGlPA----------------------AAmhE--kV--------- 333
JCSG3087283 312 --------------YyAYvNKY---------------QP--qqGE--------------- 325
JCSG3000363 309 --------------YEGctyyq---------------rP--frevFa--qdk-------- 327
JCSG3000362 320 --------------lKAvyKKd---------------Aq--GV-------VS-------- 333
JCSG3166777 296 ----------------GHllE-----------------------EnK--Yag-------- 306
JCSG3159245 307 ---------------------------------------------------D-------- 307
JCSG1675776 365 --------------vgGgrrKI---------------Qt--dAiS-g--FtD-------- 382
JCSG3186228 344 --------------kdGktGEL---------------S---------------------- 352
JCSG3210607 299 --------------YlG------------------------------------------- 301

QUERY       355 L------NG---------------------YYIYKF----FD------QVAVDNTA--KS 375
JCSG3186572 331 L------NG---------------------YYIYKF----FD------QVAVDNTA--KS 351
JCSG2998868 347 e------SAaekdadptkaqknkqnytpakWdIqKY----vt------tnSfiNNd--KS 388
JCSG3196065 356 L------TG---------------------YnVWKW----IDydnynypyAgaGSp--df 382
JCSG2998305 351 ytseasrTG---------------------FmMrKY----FE------EsTpiNdV--QS 377
JCSG3000088 347 I------Dt---------------------Y-------------------GngTiT--SN 358
JCSG3292365 354 g------Tv---------------------kYIapFcnk-YQ------gVlLDGASq-RS 378
JCSG3085978 343 t------EG---------------------WsVFKF----sN------lnSngQpG--KN 363
JCSG3166070 334 -------------------------------YLaKF----pg------KTGdDpkT--N- 349
JCSG3087283 326 -------------------------------------------------------n--iT 328
JCSG3000363 328 w------Kt---------------------YWIlKY----qNw-----KTqkDEpAppKS 351
JCSG3000362 334 y------fG---------------------pitYKF----qg------tMlegGST--RS 354
JCSG3166777 307 k------Tv---------------------WWLYKL----rg------tdl--KTA--pl 325
JCSG3159245 308 L-------------------------------LmKF----tD-------------A--KT 317
JCSG1675776 383 --------G---------------------lsIvKWqnyrsD------gkpVSHAT--yp 405
JCSG3186228 353 L------yG---------------------tHVrKn----Ig------yVnAQGAr--vy 373
JCSG3210607 302 ---------------------------------YKk----F-------HMrsDDTA---- 313

QUERY       376 ----DL-N-W-S-VYRYTDVLLMYAEAQVN-ADGTPNQQSID-IVNQIRGR---A----- 417
JCSG3186572 352 ----DL-N-W-S-VYRYTDVLLMYAEAQVN-ADGTPNQQSID-IVNQIRGR---A----- 393
JCSG2998868 389 ----NV-N-W-y-flRYADVLLLYAEAlnE-wkhgPDaEAyN-aINaVR-R---r----- 429
JCSG3196065 383 ----St-N-W-i-IlRYAEIyLndAEARLE-TgdVeGaRK---aVNMIRqR---V----- 422
JCSG2998305 378 ----an-G-l-TpViRYAEVLLgYlEClVE-dNqTiTQgiLDetINaVRGR---Asv--- 423
JCSG3000088 359 ----Sg-N-q-i-VFRYAgALLLYAEA-La-AlGTnDtKAcE-LLNRVRNR---A----- 399
JCSG3292365 379 ----fL-NdY-p-IYRYADcLLLlAEAKAl-lgedPTaE-----INQVReR---A----- 417
JCSG3085978 364 tlwvDt-D-F-p-MFRlgDIyLMYAEAvAR-GgegsKaSAVE-yINaLRkR---A----- 409
JCSG3166070 350 -------N-i-c-IiRlSEVyLnaAEAgLK-k-GTdiEEAqg-yLNDIiSR---r----- 388
JCSG3087283 329 ----Da-N-i-p-LiRlSEAyLnaAEAaVQ-Tgd--NaKAVk-yLNSIvqR---A----- 368
JCSG3000363 352 ----fI-N-e-r-AiRYADVLLMlAEAyMN-kgAl--DtSIg-yINQIRrR---A----- 391
JCSG3000362 355 ----fLdD-F-p-IYRYADcLLQlAmAKVl-lgedPTEE-----INaVReR---A----- 393
JCSG3166777 326 ----Ec-N-n-v-VlRlSEVyLIaAEAgcK-lgGdaavQGLg-yLNEIvkR--------- 366
JCSG3159245 318 ----kL-Q-Wvp-IFRYAETLLdlAECyANkAgGeaTaKS---LLKQVRGRsvdA----- 362
JCSG1675776 406 ----Dt-D-i-p-LFRlAEAyLtrAEAifR-qgG----DAtg-dINELRkR---A----- 443
JCSG3186228 374 ----cg-D-Y-i-fYRlpwVyLtlAEi-AN-mEG-dNaavak-yINlVRkR---Aygnaw 418
JCSG3210607 314 -------D-l-v-LmRsAEMyLIeAEAKVR--DGValDQAVa-pLNtLRta---r----- 352

QUERY       418 --------GLAPF-------------------------K-QTNA---------S--AF-- 430
JCSG3186572 394 --------GLAPF-------------------------K-QTNA---------S--AF-- 406
JCSG2998868 430 --------GyGnp-------------------------S-NTSAcdlpqgldeT--SF-- 451
JCSG3196065 423 --------GLpdL-------------------------t-ESDp---------E--kL-- 435
JCSG2998305 424 --------NMpPv-------------------------t-EVTp---------A--kL-- 436
JCSG3000088 400 --------haSeI---------------------------NTSG---------S--eL-- 411
JCSG3292365 418 --------ygkeF-------------------------f-EANk---------A--TLay 432
JCSG3085978 410 ---------yGdd-------------------------K-HNiS---------E--nW-- 421
JCSG3166070 389 --------ttdts-------------------------Q-QVST---------E--TFt- 402
JCSG3087283 369 --------N--Pe-------------------------N-SVEG---------K--TLt- 380
JCSG3000363 392 --------NLndY-------------------------SgpiTk---------E--Gv-- 405
JCSG3000362 394 --------ygSkYfnehkaeiaypndndpefytdnkwmK-pdNA---------G--A--- 430
JCSG3166777 367 --------Gnpdn-------------------------E-vTmA---------D--yt-- 379
JCSG3159245 363 --------AtdPL-------------------------N-idNl---------SgdAL-- 377
JCSG1675776 444 --------NcTrk-------------------------v-QTvT---------E--qe-- 456
JCSG3186228 419 detlyaypetAdF---------------------------tTNe---------l--AI-- 438
JCSG3210607 353 --------GVGnY-------------------------d-vTGk---------Tkeqv-- 367

QUERY       431 --------------------LEEVWDQRYF--DLCYENKMWFDMLR-------------- 454
JCSG3186572 407 --------------------LEEVWDQRYF--DLCYENKMWFDMLR-------------- 430
JCSG2998868 452 --------------------rEaVrkERsY--ELsFEGhrrqDLIRwgiyyk-------- 481
JCSG3196065 436 --------------------rElIrkERrI--EFAFEEQrFYDVrR-------------- 459
JCSG2998305 437 --------------------rEiVrhERrI--ELAmEGirYWDIMRwgiahevlsqkiwg 474
JCSG3000088 412 --------------------MDaIFwERcr--ELigEGhyYYDLVR-------------- 435
JCSG3292365 433 pndkgdfytdnkymsgdedpLEaIlkERmr--EFmFEGKrWYDLrl-------------- 476
JCSG3085978 422 --------------------LEEnnfRNlL--DergRElyWegIrR-------------- 445
JCSG3166070 403 --------------------LDRIlkERrk--ELvgEGEVFYDyLR-------------- 426
JCSG3087283 381 --------------------LENVlDERrk--ELvaEGhrmYDVIRngm----------- 407
JCSG3000363 406 --------------------FEDLvhQRaI--EFfvEGErFYDLrR-------------- 429
JCSG3000362 431 --------------------LEaIlkERlr--EFmFEGKrWYDI---------------- 452
JCSG3166777 380 --------------------LDRVlDERsk--ELvgEGhrFFDLLR-------------- 403
JCSG3159245 378 --------------------kEaIYNEKrL--EFigEGirgIDIMR-------------- 401
JCSG1675776 457 --------------------LiDeWaREFYlegrrrSDlVrFgMFt-------------- 482
JCSG3186228 439 --------------------LHEk-DKEFI--Q---EGQrWWDL---------------- 456
JCSG3210607 368 --------------------IDEIlmERrr--ELwgEGfgitDVLR-------------- 391

QUERY       455 ----------TRK------IRDD--KSG----EYV-D-----------------F----- 469
JCSG3186572 431 ----------TRK------IRDD--KSG----EYV-D-----------------F----- 445
JCSG2998868 482 ----------TvQ------atak--ElG----yWw-E-----------------g----- 496
JCSG3196065 460 ----------wKi------gpEt--QTtlhgvRFV-S-----------------p----- 478
JCSG2998305 475 apypgstqyaTtt------kEvD--pTG----NYr-w-----------------Y----- 499
JCSG3000088 436 ----------TgK------V---------------------------------------- 439
JCSG3292365 477 ----------lg----------------------A-D-----------------Y----- 481
JCSG3085978 446 ----------Tdl------VRfDlltSG----SYTwD-----------------F----- 463
JCSG3166070 427 ----------Ngl------aiEr--KGS----wHL-E-----------------t----- 441
JCSG3087283 408 ----------TvK------riDv--KDS----Di-------------------------- 419
JCSG3000363 430 ----------wgl------LEQtl-KTc----DdT-r-----------------Y----- 445
JCSG3000362 453 -----------Rl------LgwD--yvh----QY-------------------------- 463
JCSG3166777 404 ----------NgK------tivr--KGG----yHL-p-----------------s----- 418
JCSG3159245 402 --------------------------rG----EHf-i-----------------k----- 408
JCSG1675776 483 ----------TNK------ylwD--wKG----gaM-N-----------------g----- 497
JCSG3186228 457 -----------RR------Mtlt--KGG----tpL-v-----------------Fckegs 475
JCSG3210607 392 ----------NQKavermaLsED--mQk----teV-DcwqeggsfakrnplghwF----- 429

QUERY       470 -IGYKTNWGKVYTE--T-----QLLF--PIPLSERQANPNLTQNQGY 506
JCSG3186572 446 -IGYKTNWGKVYTE--T-----QLLF--PIPLSERQANPNLTQNQGY 482
JCSG2998868 497 -tGspNysvaTYTEegk-----HeLF--PIPqrDmDlciQFNQN--- 532
JCSG3196065 479 -teFKVTktdIrTw--N-----DrLYltPVPhDEivrSsvLkQNlGY 517
JCSG2998305 500 -VGkRA----frNp--T-----DytW--PIPqSEQNiNPNL------ 526
JCSG3000088 438 ----------------------------------------------- 439
JCSG3292365 482 -VtkRTS----aVa--T-----RLLW--PIneSvltdNPaLkQTpGY 514
JCSG3085978 464 -kG-giNtGvgvNK--r-----ynVY--PIPVTDltVNgNLqQNEGY 499
JCSG3166070 442 -LkaSNaqkieaTD--l-----RIaL--PIPqSEiDANPNIqQN--- 475
JCSG3087283 420 ---nKTKhNtAYmE--ydwnfhKILL--PIPkKEmDANPNMkQNpGY 459
JCSG3000363 446 -kNYQTGkSdniNK--f-----N-yF--PIPaKElDTNPlcTpSEGW 481
JCSG3000362 464 ---------SsaeQ--S-----RLLW--PIdaGtltnNsaLkQTpGY 492
JCSG3166777 419 -VdeEVDWdfy-----------KcVL--PIPeDQfifSPEMeQNpGY 451
JCSG3159245 409 -VGeNeTiNvgpSD--e-----KytW--PIPqvElllNkDINK---- 441
JCSG1675776 498 -tSvaSyYNK---------------Y--PIPVSDiNnNrNMSQNEGY 526
JCSG3186228 476 lLGdapilNKstea--h-----KLLW--PIekTmlNkDPaLeQTpGY 513
JCSG3210607 430 -LNFpdGkAfsaNS--S-----yyLY--aIPeKEiNANPNL------ 460

Note
Homologous search is done using BLAST from NCBI BLAST against database pdbnr with expect (E-value cut-off) at 0.001. The structure of a PDB sequence may be fully or partly solved. The non-redundant database pdbnr consists of unique PDB sequences from the representative PDB chains. Each representative chain has the best structural coverage in the set of the same sequences. You could click a sequence ID to see all of PDB chains associated with the sequence ID plus sequence alignments and structural coverages.



Contact Webmaster JCSG Menu