LOADING...
   YP_001304549.1;SP13991A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001304549.1    PDB Fold Similairty





PDB sequences with significant alignments
Sequence information                                           Score	E-value
JCSG3298905|pdb|4R03_A|Uncharacterized protein                    229	4e-61
JCSG3299563|pdb|4R8O_A|Uncharacterized protein                    58	2e-09
JCSG3169606|pdb|3MSW_A|uncharacterized protein                    44	3e-05
PDB sequence alignments
QUERY       29  KDYLYDTKEENGKIISKVVFLQEN---GLLNKQVRYEFQYNENGKVSEKKAFRWDRTNDE 85
JCSG3298905 2   KDYLYDTKEENGKIISKVVFLQEN---GLLNKQVRYEFQYNENGKVSEKKAFRWDRTNDE 58
JCSG3299563 9   ---IYNAEEvNGvVVSETIFkMEG---tMLTNyMKHNYKYDaNNQrTEdEAqKWNsNKNR 62
JCSG3169606 6   KQFIHNdtmEGGKLVcReIYaMNDaasGILNpvkmYKYSYDtDqQkTvKSTYaWNifKNt 65

QUERY       86  W-VPFYQITYQYDDQSGEIKTNYGMWDKKKKNFSLNVQNMIIPSTNYEEIFS 136
JCSG3298905 59  W-VPFYQITYQYDDQSGEIKTNYGMWDKKKKNFSLNVQNMIIPSTNYEEIFS 109
JCSG3299563 63  W-ennlcIrYtYgNKS--MtTEYykWNSKKKEYiL----------------- 94
JCSG3169606 66  WeTesrtVisRYEt---EtSVEYSVWNKEKgSFDLSkKyIyItDNNnQlI-- 112

Note
Homologous search is done using BLAST from NCBI BLAST against database pdbnr with expect (E-value cut-off) at 0.001. The structure of a PDB sequence may be fully or partly solved. The non-redundant database pdbnr consists of unique PDB sequences from the representative PDB chains. Each representative chain has the best structural coverage in the set of the same sequences. You could click a sequence ID to see all of PDB chains associated with the sequence ID plus sequence alignments and structural coverages.



Contact Webmaster JCSG Menu