LOADING...
   YP_001304276.1;SP16569N
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001304276.1    PDB Fold Similairty





PDB sequences with significant alignments
Sequence information                                           Score	E-value
JCSG3250253|pdb|4FJ6_A|glycoside hydrolase family 33, candi...    1058	0.0
JCSG3299882|pdb|4Q6K_A|BNR/Asp-box repeat protein                 747	0.0
JCSG346462|pdb|4BBW_A|SIALIDASE (NEURAMINIDASE)                   743	0.0
JCSG214652|pdb|1EUR_A|SIALIDASE                                   124	1e-28
JCSG214653|pdb|1EUT_A|SIALIDASE                                   124	1e-28
JCSG975629|pdb|1WCQ_A|SIALIDASE                                   123	4e-28
JCSG485245|pdb|2BZD_A|BACTERIAL SIALIDASE                         122	6e-28
JCSG480234|pdb|2BER_A|BACTERIAL SIALIDASE                         122	8e-28
JCSG457214|pdb|1W8N_A|BACTERIAL SIALIDASE                         122	8e-28
JCSG220435|pdb|3SIL_A|SIALIDASE                                   117	3e-26
JCSG213530|pdb|2SIL_A|SIALIDASE                                   117	3e-26
JCSG3262626|pdb|4J9T_A|designed unnatural amino acid depend...    114	2e-25
JCSG3295931|pdb|4L2E_A|Sialidase                                  107	2e-23
JCSG1013555|pdb|2BF6_A|EXO-ALPHA-SIALIDASE                        107	2e-23
JCSG1670835|pdb|2VK5_A|EXO-ALPHA-SIALIDASE                        107	2e-23
JCSG470940|pdb|1WCS_A|SIALIDASE                                   85	1e-16
JCSG976051|pdb|2AGS_A|sialidase                                   85	1e-16
JCSG277846|pdb|1N1V_A|Sialidase                                   84	2e-16
JCSG2865645|pdb|2VVZ_A|SIALIDASE A                                83	5e-16
JCSG2885338|pdb|2W20_A|SIALIDASE A                                83	5e-16
...more
PDB sequence alignments
QUERY       1   MKKTFLYFCLLFIVQTAF---AADSIYVREQQIPILIDRIDNVLYEMRIPAQKGDVLNEI 57
JCSG3250253 2   ----------------------ADSIYVREQQIPILIDRIDNVLYEMRIPAQKGDVLNEI 39
JCSG3299882 4   ----------------------SDTVFVREtQIPILIERqDNVLFmLRLnAKESrsLDEV 41
JCSG346462  1   MKRNhylFtLILLLgcSIfvkASDTVFVHQtQIPILIERqDNVLFyFRLdAKESrMMDEI 60
JCSG214652      ------------------------------------------------------------
JCSG214653      ------------------------------------------------------------
JCSG975629      ------------------------------------------------------------
JCSG485245      ------------------------------------------------------------
JCSG480234      ------------------------------------------------------------
JCSG457214      ------------------------------------------------------------
JCSG220435      ------------------------------------------------------------
JCSG213530      ------------------------------------------------------------
JCSG3262626     ------------------------------------------------------------
JCSG3295931     ------------------------------------------------------------
JCSG3295931     ------------------------------------------------------------
JCSG1013555     ------------------------------------------------------------
JCSG1013555     ------------------------------------------------------------
JCSG1670835     ------------------------------------------------------------
JCSG1670835     ------------------------------------------------------------
JCSG470940      ------------------------------------------------------------
JCSG976051      ------------------------------------------------------------
JCSG277846      ------------------------------------------------------------
JCSG2865645     ------------------------------------------------------------
JCSG2885338     ------------------------------------------------------------

QUERY       58  TIQIGDNVDLSDIQAIRLFYSGVEAPSRKGE-HF-SPVTYISSHIPGNTRKALESYSVRQ 115
JCSG3250253 40  TIQIGDNVDLSDIQAIRLFYSGVEAPSRKGE-HF-SPVTYISSHIPGNTRKALESYSVRQ 97
JCSG3299882 42  VLNFGkDVNMADIQSVKLYYSGTEArQNyGK-kFfTPVSYISSHtPGKTlaAnpSYSINK 100
JCSG346462  61  VLDFGkSVNLSDVQAVKLYYGGTEAlQdKGKkRF-APVdYISSHrPGNTlaAIpSYSIKc 119
JCSG214652      ------------------------------------------------------------
JCSG214653      ------------------------------------------------------------
JCSG975629      ------------------------------------------------------------
JCSG485245      ------------------------------------------------------------
JCSG480234      ------------------------------------------------------------
JCSG457214      ------------------------------------------------------------
JCSG220435      ------------------------------------------------------------
JCSG213530      ------------------------------------------------------------
JCSG3262626     ------------------------------------------------------------
JCSG3295931     ------------------------------------------------------------
JCSG3295931     ------------------------------------------------------------
JCSG1013555     ------------------------------------------------------------
JCSG1013555     ------------------------------------------------------------
JCSG1670835     ------------------------------------------------------------
JCSG1670835     ------------------------------------------------------------
JCSG470940      ------------------------------------------------------------
JCSG976051      ------------------------------------------------------------
JCSG277846      ------------------------------------------------------------
JCSG2865645     ------------------------------------------------------------
JCSG2885338     ------------------------------------------------------------

QUERY       116 DEVTAPLSRTVKLTSKQPMLKGINYFWVSIQMKPETSLLAKVATTMPNAQINNKPINITW 175
JCSG3250253 98  DEVTAPLSRTVKLTSKQPMLKGINYFWVSIQMKPETSLLAKVATTMPNAQINNKPINITW 157
JCSG3299882 101 SQVNnP-GRkViLNANQkLFpGINYFWISLQMKPgASLLdKVSAkIvTVKVDNKealMht 159
JCSG346462  120 aEAlqPsAKVV-LkShykLFpGINFFWISLQMKPETSLFTKISSeLqSVKIDGKeaicee 178
JCSG214652      ------------------------------------------------------------
JCSG214653      ------------------------------------------------------------
JCSG975629      ------------------------------------------------------------
JCSG485245      ------------------------------------------------------------
JCSG480234      ------------------------------------------------------------
JCSG457214      ------------------------------------------------------------
JCSG220435      ------------------------------------------------------------
JCSG213530      ------------------------------------------------------------
JCSG3262626     ------------------------------------------------------------
JCSG3295931     ------------------------------------------------------------
JCSG3295931     ------------------------------------------------------------
JCSG1013555     ------------------------------------------------------------
JCSG1013555     ------------------------------------------------------------
JCSG1670835     ------------------------------------------------------------
JCSG1670835     ------------------------------------------------------------
JCSG470940      ------------------------------------------------------------
JCSG976051      ------------------------------------------------------------
JCSG277846      ------------------------------------------------------------
JCSG2865645     ------------------------------------------------------------
JCSG2885338     ------------------------------------------------------------

QUERY       176 KGKVDERH-VGIGVRQAGD-DGSAA-FRIPGLVTTNNGTLLGVYDIRYNSS-----VDL- 226
JCSG3250253 158 KGKVDERH-VGIGVRQAGD-DGSAA-FRIPGLVTTNNGTLLGVYDIRYNSS-----VDL- 208
JCSG3299882 160 vSpeNiaHrVGVGVRHAGD-DGSAA-FRIPGLATTNKGTLLGVYDVRYNSS-----VDL- 211
JCSG346462  179 RSpkDiiHrMAVGVRHAGD-DGSAS-FRIPGLVTSNKGTLLGVYDVRYNSS-----VDL- 230
JCSG214652  18  -----------------Gr-EGfpn-YRIPALTVTpDGdLLAsYDgR-pTG-----IDa- 51
JCSG214653  18  -----------------Gr-EGfpn-YRIPALTVTpDGdLLAsYDgR-pTG-----IDa- 51
JCSG975629  14  -----------------Gr-EGfpn-YRIPALTVTpDGdLLAsYDgR-pTG-----IDa- 47
JCSG485245  14  -----------------Gr-EGfpn-YRIPALTVTpDGdLLAsYDgR-pTG-----IDa- 47
JCSG480234  14  -----------------Gr-EGfpn-YRIPALTVTpDGdLLAsYDgR-pTG-----IDa- 47
JCSG457214  14  -----------------Gr-EGfpn-YRIPALTVTpDGdLLAsYDgR-pTG-----Iga- 47
JCSG220435  33  --------------------------FRIPAMcTTSKGTIVvfaDaRHNTA-----sD-- 59
JCSG213530  35  --------------------------FRIPAMcTTSKGTIVvfaDaRHNTA-----sD-- 61
JCSG3262626 14  -----------------Gr-EGfpn-YshPALTVTpDGdLLAsYDgR-pTG-----Iaa- 47
JCSG3295931     ------------------------------------------------------------
JCSG3295931 21  ----------------------SSn-YRIPALfkTKEGTLIAsiDaRrQGG-----ADap 52
JCSG1013555     ------------------------------------------------------------
JCSG1013555 20  ----------------------SSn-YRIPALfkTKEGTLIAsiDaRrHGG-----ADap 51
JCSG1670835     ------------------------------------------------------------
JCSG1670835 20  ----------------------SSn-YRIPALfkTKEGTLIAsiDaRrHGG-----ADap 51
JCSG470940  37  ------------------------S-FRIPtIVNVD-GVMVAIaDaRYETS-----fD-- 63
JCSG976051  48  ------------------------S-FRIPtIVNVD-GVMVAIaDaRYETS-----fD-- 74
JCSG277846  37  ------------------------S-FRIPtIVNVD-GVMVAIaDaRYETS-----fD-- 63
JCSG2865645     ------------------------------------------------------------
JCSG2885338     ------------------------------------------------------------

QUERY       227 QEKIDIGVSRSTDKGQT------WEPMRVAMTF--------------KQ--TDGLPHGQN 264
JCSG3250253 209 QEKIDIGVSRSTDKGQT------WEPMRVAMTF--------------KQ--TDGLPHGQN 246
JCSG3299882 212 QEhVDVGLSRSVDgGKT------WEkMRLpLAF--------------gE--TgGLPaAQN 249
JCSG346462  231 QEyVDVGLSRSTDgGKT------WEkMRLpLSF--------------gE--yDGLPaAQN 268
JCSG214652  52  pgpnSIlqrRSTDgGRT------WgeQQVVsAg--------------Qt--TapI----K 85
JCSG214653  52  pgpnSIlqrRSTDgGRT------WgeQQVVsAg--------------Qt--TapI----K 85
JCSG975629  48  pgpnSIlqrRSTDgGRT------WgeQQVVsAg--------------Qt--TapI----K 81
JCSG485245  48  pgpnSIlqrRSTDgGRT------WgeQQVVsAg--------------Qt--TapI----K 81
JCSG480234  48  pgpnSIlqrRSTDgGRT------WgeQQVVsAg--------------Qt--TapI----K 81
JCSG457214  48  pgpnSIlqrRSTDgGRT------WgeQQVVsAg--------------Qt--TapI----K 81
JCSG220435  60  QSfIDtAAARSTDgGKT------WN-kKIAI-----------------y--NDrVnsklS 93
JCSG213530  62  QSfIDtAAARSTDgGKT------WN-kKIAI-----------------y--NDrVnsklS 95
JCSG3262626 48  pgpnSIlqrRSTDgGRT------WgeQQVVsAg--------------Qt--TapI----K 81
JCSG3295931     ------------------------------------------------------------
JCSG3295931 53  NNdIDtAVrRSeDgGKT------WDegQIiMdY--------------pD---------KS 83
JCSG1013555     ------------------------------------------------------------
JCSG1013555 52  NNdIDtAVrRSeDgGKT------WDegQIiMdY--------------pD---------KS 82
JCSG1670835     ------------------------------------------------------------
JCSG1670835 52  NNdIDtAVrRSeDgGKT------WDegQIiMdY--------------pD---------KS 82
JCSG470940  64  NSfIEtAVKySVDdGaT------WNt-QIAIkn--------------SR--ASSVsR--- 97
JCSG976051  75  NSfIEtAVKySVDdGaT------WNt-QIAIkn--------------SR--ASSVsR--- 108
JCSG277846  64  NSfIEtAVKySVDdGaT------WNt-QIAIkn--------------SR--ASSVsR--- 97
JCSG2865645     ------------------------------------------------------------
JCSG2885338     ------------------------------------------------------------

QUERY       265 GVG------------DPSILV---DEKT-NTIWVVA-AWTHGMGNERAWWNSMPGM-TPD 306
JCSG3250253 247 GVG------------DPSILV---DEKT-NTIWVVA-AWTHGMGNERAWWNSMPGM-TPD 288
JCSG3299882 250 GVG------------DPSILV---DtKT-NTtWVVA-AWTHGMGNQRAWWSSyPGM-dmN 291
JCSG346462  269 GVG------------DPSILV---DtQT-NTIWVVA-AWTHGMGNQRAWWSShPGM-dly 310
JCSG214652  86  GfS------------DPSyLV---DRET-GTIFnfh-VYSQrQG----FaGSrPGt-dPa 123
JCSG214653  86  GfS------------DPSyLV---DRET-GTIFnfh-VYSQrQG----FaGSrPGt-dPa 123
JCSG975629  82  GfS------------DPSyLV---DRET-GTIFnfh-VYSQrQG----FaGSrPGt-dPa 119
JCSG485245  82  GfS------------DPSyLV---DRET-GTIFnfh-VYSQrQG----FaGSrPGt-dPa 119
JCSG480234  82  GfS------------DPSyLV---DRET-GTIFnfh-VYSQrQG----FaGSrPGt-dPa 119
JCSG457214  82  GfS------------DPSyLV---DRET-GTIFnfh-VYSQrQG----FaGSrPGt-dPa 119
JCSG220435  94  rVm------------DPTcIVaniQgRe-TiLvMVG-kW----NNNdktWGAyrdk-APD 134
JCSG213530  96  rVm------------DPTcIVaniQgRe-TiLvMVG-kW----NNNdktWGAyrdk-APD 136
JCSG3262626 82  GfS------------hPSyLV---DRET-GTIFnfh-VYSQrQG----WeGSrPGt-dPa 119
JCSG3295931     ------------------------------------------------------------
JCSG3295931 84  SVi------------DtTLIq---DDET-GrIFLLV---TH-FpSKyGFWNAglGsgfkN 123
JCSG1013555     ------------------------------------------------------------
JCSG1013555 83  SVi------------DtTLIq---DDET-GrIFLLV---TH-FpSKyGFWNAglGsgfkN 122
JCSG1670835     ------------------------------------------------------------
JCSG1670835 83  SVi------------DtTLIq---DDET-GrIFLLV---TH-FpSKyGFWNAglGsgfkN 122
JCSG470940  98  -Vv------------DPTVIV-----Kg-NkLYILV-G---SFNKtRnYWTQhrdg-Sdw 133
JCSG976051  109 -Vm------------DaTVIV-----Kg-NkLYILV-GsfNktrN--SWtQhrdG----S 142
JCSG277846  98  -Vm------------DaTVIV-----Kg-NkLYILV-GsfNktrN--SWtQhrdG----S 131
JCSG2865645     ------------------------------------------------------------
JCSG2885338     ------------------------------------------------------------

QUERY       307 ETA------------QLM--L---V----KSEDDGKT-----WSE-PINIT----SQV-K 334
JCSG3250253 289 ETA------------QLM--L---V----KSEDDGKT-----WSE-PINIT----SQV-K 316
JCSG3299882 292 HTA------------QLV--L---s----KStDDGKT-----WSE-PINIT----DQV-K 319
JCSG346462  311 QTA------------QLV--M---A----KStDDGKT-----WSK-PINIT----EQV-K 338
JCSG214652  124 Dpn------------vLhanV---A----tStDgGlT-----WSH-rtitA----DiT-p 153
JCSG214653  124 Dpn------------vLhanV---A----tStDgGlT-----WSH-rtitA----DiT-p 153
JCSG975629  120 Dpn------------vLhanV---A----tStDgGlT-----WSH-rtitA----DiT-p 149
JCSG485245  120 Dpn------------vLhanV---A----tStDgGlT-----WSH-rtitA----DiT-p 149
JCSG480234  120 Dpn------------vLhanV---A----tStDgGlT-----WSH-rtitA----DiT-p 149
JCSG457214  120 Dpn------------vLhanV---A----tStDgGlT-----WSH-rtitA----DiT-p 149
JCSG220435  135 tdw------------DLV--L---y----KStDDGvT-----FSKvetNIh----DiVtK 164
JCSG213530  137 tdw------------DLV--L---y----KStDDGvT-----FSKvetNIh----DiVtK 166
JCSG3262626 120 Dpn------------vLhanV---A----tStDgGlT-----WSH-rtitA----DiT-p 149
JCSG3295931 187 -TS------------yIn--L---V----ySDDDGKT-----WSE-PqNIN----fQV-K 213
JCSG3295931 124 idG------------Key--L---c----lyDSSGKe-----FTv-reNVV----yDk-d 151
JCSG1013555 186 -TS------------yIn--L---V----ySDDDGKT-----WSE-PqNIN----fQV-K 212
JCSG1013555 123 idG------------Key--L---c----lyDSSGKe-----FTv-reNVV----yDk-d 150
JCSG1670835 186 -TS------------yIn--L---V----ySDDDGKT-----WSE-PqNIN----fQV-K 212
JCSG1670835 123 idG------------Key--L---c----lyDSSGKe-----FTv-reNVV----yDk-d 150
JCSG470940  134 Epl------------lVVgeV---T----KSaaNGKTtatisWGK-PVSLk----plf-p 168
JCSG976051  143 Dwe------------pLL--V---VgevtKSaaNGKTtatisWGK-PVSLkplfpAEf-d 183
JCSG277846  132 Dwe------------pLL--V---VgevtKSaaNGKTtatisWGK-PVSLk----plf-p 168
JCSG2865645 218 ----------------Lw--M---s----ySDDDGKT-----WSa-PqDIT----pMV-K 241
JCSG2885338 216 ----------------Lw--M---s----ySDDDGKT-----WSa-PqDIT----pMV-K 239

QUERY       335 DPS---WYFLLQ----GPGRGITM---------Q----D----G--T----LVFP----- 359
JCSG3250253 317 DPS---WYFLLQ----GPGRGITM---------Q----D----G--T----LVFP----- 341
JCSG3299882 320 DPS---WYFLLQ----GPGRGITM---------Q----D----G--T----LVFP----- 344
JCSG346462  339 DPS---WYFLLQ----GPGRGITM---------S----D----G--T----LVFP----- 363
JCSG214652  154 DPG---WrsrFa----AsGEGIqL---------Rygpha----G--r----LIqq----- 182
JCSG214653  154 DPG---WrsrFa----AsGEGIqL---------Rygpha----G--r----LIqq----- 182
JCSG975629  150 DPG---WrsrFa----AsGEGIqL---------Rygpha----G--r----LIqq----- 178
JCSG485245  150 DPG---WrsrFa----AsGEGIqL---------Rygpha----G--r----LIqq----- 178
JCSG480234  150 DPG---WrsrFa----AsGEGIqL---------Rygpha----G--r----LIqq----- 178
JCSG457214  150 DPG---WrsrFa----AsGEGIqL---------Rygpha----G--r----LIqq----- 178
JCSG220435  165 NgT---isaMLg----GvGsGLqL---------N----D----G--k----LVFP----- 189
JCSG213530  167 NgT---isaMLg----GvGsGLqL---------N----D----G--k----LVFP----- 191
JCSG3262626 150 DPG---WrsrFa----AsGEGIqL---------Rygpha----G--r----LIqq----- 178
JCSG3295931 214 kdw---mkFLgi----APGRGIqI---------K----NgehkG--r----IVvP----- 242
JCSG3295931 152 gnK---teYttN------AlGdlF---------R----N----G--T----kIdn----- 174
JCSG1013555 213 kdw---mkFLgi----APGRGIqI---------K----NgehkG--r----IVvP----- 241
JCSG1013555 151 SnK---teYttN------AlGdlF---------K----N----G--T----kIdn----- 173
JCSG1670835 213 kdw---mkFLgi----APGRGIqI---------K----NgehkG--r----IVvP----- 241
JCSG1670835 151 SnK---teYttN------AlGdlF---------K----N----G--T----kIdn----- 173
JCSG470940  169 aef---dgILtKefvgGvGaAIVa---------S----N----G--N----LVYP----- 197
JCSG976051  184 gil---tkeFIg----GvGaAIVa---------S----N----G--N----LVYP----- 208
JCSG277846  169 aef---dgILtKefvgGvGaAIVa---------S----N----G--N----LVYP----- 197
JCSG2865645 242 adw---mkFLgv----GPGtGIVL---------R----NgphkG--r----ILIP----- 270
JCSG2885338 240 adw---mkFLgv----GPGtGIVL---------R----NgphkG--r----ILIP----- 268

QUERY       360 -IQF----I---DATR-----VPNAG----IMYSKDRGKTW---------------H--- 384
JCSG3250253 342 -IQF----I---DATR-----VPNAG----IMYSKDRGKTW---------------H--- 366
JCSG3299882 345 -IQF----I---DSTR-----VPNAG----IMYSKDRGETW---------------k--- 369
JCSG346462  364 -tQF----I---DSTR-----VPNAG----IMYSKDRGKTW---------------k--- 388
JCSG214652  183 -ytI----I---NAAg-----AfQAv----sVYSdDHGRTW---------------R--- 207
JCSG214653  183 -ytI----I---NAAg-----AfQAv----sVYSdDHGRTW---------------R--- 207
JCSG975629  179 -ytI----I---NAAg-----AfQAv----sVYSdDHGRTW---------------R--- 203
JCSG485245  179 -ytI----I---NAAg-----AfQAv----sVYSdDHGRTW---------------R--- 203
JCSG480234  179 -ytI----I---NAAg-----AfQAv----sVYSdDHGRTW---------------R--- 203
JCSG457214  179 -ytI----I---NAAg-----AfQAv----sVYSdDHGRTW---------------R--- 203
JCSG220435  190 -VQM----VrtkNiTt-----VlNTS----FIYStD-GiTW---------------s--- 216
JCSG213530  192 -VQM----VrtkNiTt-----VlNTS----FIYStD-GiTW---------------s--- 218
JCSG3262626 179 -yaI----I---NAAg-----AiQAv----sVYSdDHGRTW---------------R--- 203
JCSG3295931 243 -VyY----t---Nekg-----kqSSA----VIYSdDsGKNW---------------t--- 267
JCSG3295931 175 -INsstapL---kAkg-----TsyiN----LVYSdDdGKTWsepqninfqvkkdwmk--- 218
JCSG1013555 242 -VyY----t---Nekg-----kqSSA----VIYSdDsGKNW---------------t--- 266
JCSG1013555 174 -INsstapL---kAkg-----TsyiN----LVYSdDdGKTWsepqninfqvkkdwmk--- 217
JCSG1670835 242 -VyY----t---Nekg-----kqSSA----VIYSdDsGKNW---------------t--- 266
JCSG1670835 174 -INsstapL---kAkg-----TsyiN----LVYSdDdGKTWsepqninfqvkkdwmk--- 217
JCSG470940  198 -VQI----a---Dmgg-----rvfTk----IMYSEDdGNTW---------------k--- 222
JCSG976051  209 -VQI----a---Dmgg-----rvfTk----IMYSEDdGNTW---------------k--- 233
JCSG277846  198 -VQI----a---Dmgg-----rvfTk----IMYSEDdGNTW---------------k--- 222
JCSG2865645 271 -Vyt----t---NnVs-----hlNGSqssrIIYSdDHGKTW---------------Hage 302
JCSG2885338 269 -Vyt----t---NnVs-----hlNGSqssrIIYSdDHGKTW---------------Hage 300

QUERY       385 ------------L-H----N-------------LA---RTN------------------- 392
JCSG3250253 367 ------------L-H----N-------------LA---RTN------------------- 374
JCSG3299882 370 ------------I-H----N-------------yA---RTN------------------- 377
JCSG346462  389 ------------M-H----N-------------MA---RTN------------------- 396
JCSG214652  208 ------------a-g----E-------------aV---gVG------------------- 215
JCSG214653  208 ------------a-g----E-------------aV---gVG------------------- 215
JCSG975629  204 ------------a-g----E-------------aV---gVG------------------- 211
JCSG485245  204 ------------a-g----E-------------aV---gVG------------------- 211
JCSG480234  204 ------------a-g----E-------------aV---gVG------------------- 211
JCSG457214  204 ------------a-g----E-------------aV---gVG------------------- 211
JCSG220435  217 ------------Lps----G-------------yC---Egf------------------- 225
JCSG213530  219 ------------Lps----G-------------yC---Egf------------------- 227
JCSG3262626 204 ------------a-g----E-------------aV---gVG------------------- 211
JCSG3295931 268 ------------I-g----E-------------sp---NdNrklengkiinsktlsddap 294
JCSG3295931 219 ------------F-l----G-------------IA---pgR------------------- 226
JCSG1013555 267 ------------I-g----E-------------sp---NdNrklengkiinsktlsddap 293
JCSG1013555 218 ------------F-l----G-------------IA---pgR------------------- 225
JCSG1670835 267 ------------I-g----E-------------sp---NdNrklengkiinsktlsddap 293
JCSG1670835 218 ------------F-l----G-------------IA---pgR------------------- 225
JCSG470940  223 ------------FaE----G-------------rS---KfG------------------- 231
JCSG976051  234 ------------FaE----G-------------rS---KfG------------------- 242
JCSG277846  223 ------------FaE----G-------------rS---KfG------------------- 231
JCSG2865645 303 avndnrqvdgqkI-HsstmN-------------nr---RAQ------------------- 326
JCSG2885338 301 avndnrqvdgqkI-HsstmN-------------nr---RAQ------------------- 324

QUERY       393 -TTEAQVAEVEPG---VLMLNMR-DN-RG--------G--SRAVA--TTKDLGKTWT--E 432
JCSG3250253 375 -TTEAQVAEVEPG---VLMLNMR-DN-RG--------G--SRAVA--TTKDLGKTWT--E 414
JCSG3299882 378 -TTEAQVAEVEPG---VLMLNMR-DN-RG--------G--SRAVA--TTKDLGKTWT--E 417
JCSG346462  397 -TTEAQVVETEPG---VLMLNMR-DN-RG--------G--SRAVA--iTKDLGKTWT--E 436
JCSG214652  216 -mdEnKTVELSdG---rVLLNsR-DSaRS--------G--yRkVA--VStDgGhSYg--p 256
JCSG214653  216 -mdEnKTVELSdG---rVLLNsR-DSaRS--------G--yRkVA--VStDgGhSYg--p 256
JCSG975629  212 -mdEnKTVELSdG---rVLLNsR-DSaRS--------G--yRkVA--VStDgGhSYg--p 252
JCSG485245  212 -mdanKTVELSdG---rVLLNsR-DSaRS--------G--yRkVA--VStDgGhSYg--p 252
JCSG480234  212 -mdEnKTVELSdG---rVLLNsR-DSaRS--------G--yRkVA--VStDgGhSYg--p 252
JCSG457214  212 -mdEnKTVELSdG---rVLLNsR-DSaRS--------G--yRkVA--VStDgGhSYg--p 252
JCSG220435  226 -gSEnNIiEfNaS----LVnNIR-NS-----------G--lRrsf--eTKDFGKTWT--E 262
JCSG213530  228 -gSEnNIiEfNaS----LVnNIR-NS-----------G--lRrsf--eTKDFGKTWT--E 264
JCSG3262626 212 -mSHnKTVELSdG---rVLLNsa-DSaRS--------G--yRkVA--VStDgGhSYg--p 252
JCSG3295931 295 qlTECQVVEMpnG---qLkLfMR--N-lS--------G--ylnIA--TSfDgGaTWd--E 334
JCSG3295931 227 -giQiKnGEhKgr---IVVpvyy-tN-Ek--------GkqSsAVi--ySdDsGKNWTigE 270
JCSG1013555 294 qlTECQVVEMpnG---qLkLfMR--N-lS--------G--ylnIA--TSfDgGaTWd--E 333
JCSG1013555 226 -giQiKnGEhKgr---IVVpvyy-tN-Ek--------GkqSsAVi--ySdDsGKNWTigE 269
JCSG1670835 294 qlTECQVVEMpnG---qLkLfMR--N-lS--------G--ylnIA--TSfDgGaTWd--E 333
JCSG1670835 226 -giQiKnGEhKgr---IVVpvyy-tN-Ek--------GkqSsAVi--ySdDsGKNWTigE 269
JCSG470940  232 -cSEpaVlEwE-G---kLIINnR-vD-y---------N--rRlVy--eSSDMGKTWV--E 269
JCSG976051  243 -cSEpaVlEwE-G---kLIINnR-vD--G--------N--rRlVy--eSSDMGKTWV--E 280
JCSG277846  232 -cSEpaVlEwE-G---kLIINnR-vD--G--------N--rRlVy--eSSDMGKTWV--E 269
JCSG2865645 327 -NTEStVVQLNnG---dVkLfMR--G-lt--------G--DlqVA--TSKDgGvTWe--K 365
JCSG2885338 325 -NTEStVVQLNnG---dVkLfMR--G-lt--------G--DlqVA--TSKDgGvTWe--K 363

QUERY       433 ---------HPSSRSAL-------QESVCMASL-IKV--NAKDNITGKDLLLFSNPN--- 470
JCSG3250253 415 ---------HPSSRSAL-------QESVCMASL-IKV--NAKDNITGKDLLLFSNPN--- 452
JCSG3299882 418 ---------HPSSRKAL-------QEpVCMASL-ISV--KAaDNtlNKDILLFSNPN--- 455
JCSG346462  437 ---------HPSSRKAL-------QEpVCMASL-IhV--EAEDNVldKDILLFSNPN--- 474
JCSG214652  257 ---------vtiDRD-L-------pDpTnnASI-IRAfpDApaGsArakVLLFSNaa--- 295
JCSG214653  257 ---------vtiDRD-L-------pDpTnnASI-IRAfpDApaGsArakVLLFSNaa--- 295
JCSG975629  253 ---------vtiDRD-L-------pDpTnnASI-IRAfpDApaGsArakVLLFSNaa--- 291
JCSG485245  253 ---------vtiDRD-L-------pDpTnnASI-IRAfpDApaGsArakVLLFSNaa--- 291
JCSG480234  253 ---------vtiDRD-L-------pDpTnnASI-IRAfpDApaGsArakVLLFSNaa--- 291
JCSG457214  253 ---------vtiDRD-L-------pDpTnnASI-IRAfpDApaGsArakVLLFSNaa--- 291
JCSG220435  263 ---------fPpmdKkVdn-----RNhgvQGSt-ItI--pSgNKLVAahssa-QNkN--- 301
JCSG213530  265 ---------fPpmdKkVdn-----RNhgvQGSt-ItI--pSgNKLVAahssa-QNkN--- 303
JCSG3262626 253 ---------vtiDRD-L-------pDpTndASI-IRAfpDApaGsArakVLLFSNaa--- 291
JCSG3295931 335 ---------tvEKdTnV-------lEpyCQlSV-I----NySQKIdGKDaVIFSNPN--- 370
JCSG3295931 271 ---------sPNDNrkL-------ENGkiInSk-tls--DdapQLTecQVVeMpNgQlkl 311
JCSG1013555 334 ---------tvEKdTnV-------lEpyCQlSV-I----NySQKVdGKDaVIFSNPN--- 369
JCSG1013555 270 ---------sPNDNrkL-------ENGkiInSk-tls--DdapQLTecQVVeMpNgQlkl 310
JCSG1670835 334 ---------tvEKdTnV-------lEpyCQlSV-I----NySQKVdGKDaVIFSNPN--- 369
JCSG1670835 270 ---------sPNDNrkL-------ENGkiInSk-tls--DdapQLTecQVVeMpNgQlkl 310
JCSG470940  270 ---------alGTlShVwtnsptsNQpdCQSSF-VaV------TIeGKrVMLFTHPl--- 310
JCSG976051  281 ---------alGTlShVwtnsptsNQQdCQSSF-VaV------TIeGKrVMLFTHPl--- 321
JCSG277846  270 ---------alGTlShVwtnsptsNQQdCQSSF-VaV------TIeGKrVMLFTHPl--- 310
JCSG2865645 366 ---------diKrypqV-------KDvyvQmSa-IhT--mhE----GKEyIILSNaG--- 399
JCSG2885338 364 ---------diKrypqV-------KDvyvQmSa-IhT--mhE----GKEyIILSNaG--- 397

QUERY       471 -T----TKGRNHITIKAS--L--------D--GGLTWPTEHQV------LLDEAE-GWGY 506
JCSG3250253 453 -T----TKGRNHITIKAS--L--------D--GGLTWPTEHQV------LLDEAE-GWGY 488
JCSG3299882 456 -T----VKGRHHITIKAS--L--------D--GGITWlpEHQV------MLDEGD-GWGY 491
JCSG346462  475 -T----TRGRNHITIKAS--L--------D--dGLTWlpEHQL------MLDEGE-GWGY 510
JCSG214652  296 -S----qtSRSQgTIRmS--c--------D--dGqTWPVSk---------VfQpg-SmSY 328
JCSG214653  296 -S----qtSRSQgTIRmS--c--------D--dGqTWPVSk---------VfQpg-SmSY 328
JCSG975629  292 -S----qtSRSQgTIRmS--c--------D--dGqTWPVSk---------VfQpg-SmSF 324
JCSG485245  292 -S----qtSRSQgTIRmS--c--------D--dGqTWPVSk---------VfQpg-SmSY 324
JCSG480234  292 -S----qtSRSQgTIRmS--c--------D--dGqTWPVSkvf------qpgSmS-G--- 324
JCSG457214  292 -S----qtSRSQgTIRmS--c--------D--dGqTWPVSk---------VfQpg-SmSY 324
JCSG220435  302 -N----dytRSdISLyAhnly--------S--GeVklidDfyp------kVgNAS-GaGY 339
JCSG213530  304 -N----dytRSdISLyAhnly--------S--GeVklidDfyp------kVgNAS-GaGY 341
JCSG3262626 292 -S----qtSRSQgTIRmS--c--------D--dGqTWPVSk---------VfQpg-SmSY 324
JCSG3295931 371 ------ARSRSNgTVRiG--LinqvgtyeN--GepkYefDwKyn-----kLvKpg-yYAY 414
JCSG3295931 312 fm----rNlsGYLNIaTS--F--------D--GGaTW----------------------- 332
JCSG1013555 370 ------ARSRSNgTVRiG--LinqvgtyeN--GepkYefDwKyn-----kLvKpg-yYAY 413
JCSG1013555 311 fm----rNlsGYLNIaTS--F--------D--GGaTW----------------------- 331
JCSG1670835 370 ------ARSRSNgTVRiG--LinqvgtyeN--GepkYefDwKyn-----kLvKpg-yYAY 413
JCSG1670835 311 fm----rNlsGYLNIaTS--F--------D--GGaTW----------------------- 331
JCSG470940  311 -N----lKGR-------------------------------------------------- 315
JCSG976051  322 -N----lKGR-------------------------------------------------- 326
JCSG277846  311 -N----lKGR-------------------------------------------------- 315
JCSG2865645 400 -g----pKrENgMVhlAr--V--------EenGeLTWlkHNpI------qkgE----FAY 434
JCSG2885338 398 -g----pKrENgMVhlAr--V--------EenGeLTWlkHNpI------qkgE----FAY 432

QUERY       507 SCLSM---IDKETVGIFYESSVAHMTFQAVKLQDLIHQ 541
JCSG3250253 489 SCLSM---IDKETVGIFYESSVAHMTFQAVKLQDLIHQ 523
JCSG3299882 492 SCLTM---IDKETVGILYESSVAHMTFQAIRLRDII-- 524
JCSG346462  511 SCLTM---IDRETIGILYESSAAHMTFQAVKLKDLI-- 543
JCSG214652  329 StLTa---LpdgTyGLLYE------------------- 344
JCSG214653  329 StLTa---LpdgTyGLLYE------------------- 344
JCSG975629  325 StLTa---LpdgTyGLLYE------------------- 340
JCSG485245  325 StLTa---LpdgTyGLLYE------------------- 340
JCSG480234  325 StLTa---LpdgTyGLLYE------------------- 340
JCSG457214  325 StLTa---LpdgTyGLLYE------------------- 340
JCSG220435  340 SCLSyrknVDKETLyVvYEAN------gSIEFQDL--- 368
JCSG213530  342 SCLSyrknVDKETLyVvYEAN------gSIEFQDL--- 370
JCSG3262626 325 StLTa---LpdgTyGLLYE------------------- 340
JCSG3295931 415 SCLTe---LSNgNIGLLYEGT----------------- 432
JCSG3295931 331 -------------------------------------- 332
JCSG1013555 414 SCLTe---LSNgNIGLLYEGT----------------- 431
JCSG1013555 330 -------------------------------------- 331
JCSG1670835 414 SCLTe---LSNgNIGLLYEGT----------------- 431
JCSG1670835 330 -------------------------------------- 331
JCSG470940  314 -------------------------------------- 315
JCSG976051  325 -------------------------------------- 326
JCSG277846  314 -------------------------------------- 315
JCSG2865645 435 NsLQe---LgNgeyGILYE------------------- 450
JCSG2885338 433 NsLQe---LgNgeyGILYE------------------- 448

Note
Homologous search is done using BLAST from NCBI BLAST against database pdbnr with expect (E-value cut-off) at 0.001. The structure of a PDB sequence may be fully or partly solved. The non-redundant database pdbnr consists of unique PDB sequences from the representative PDB chains. Each representative chain has the best structural coverage in the set of the same sequences. You could click a sequence ID to see all of PDB chains associated with the sequence ID plus sequence alignments and structural coverages.



Contact Webmaster JCSG Menu