LOADING...
   YP_001299918.1;GS13848A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001299918.1    PDB Fold Similairty





PDB sequences with significant alignments
Sequence information                                           Score	E-value
JCSG3297293|pdb|4QFU_E|glycoside hydrolase family 5               993	0.0
JCSG3191665|pdb|3KZS_A|glycosyl hydrolase family 5                793	0.0
PDB sequence alignments
QUERY       23  QKAKTYIPWKNGKLVVSEEGRYLKHENGVPFFWLGETGWLMPQRLNRDEVSYYLNKCKDA 82
JCSG3297293 18  QgAKTYIPWKNGKLVVSEEGRYLKHENGVPFFWLGETGWLMPQRLNRDEVSYYLNKCKDA 77
JCSG3191665 8   ---KTYIPWSNGKLVVSEEGRYLKHENGTPFFWLGETGWLLPERLNRDEAEYYLEQCKrr 64

QUERY       83  GYNMVQVQVLNGVPSMNIYGQYSMTDGFNFKDINRKGIYGYWDHMDYIIKSAASRGIYIG 142
JCSG3297293 78  GYNMVQVQVLNGVPSMNIYGQYSMTDGFNFKDINRKGIYGYWDHMDYIIKSAASRGIYIG 137
JCSG3191665 65  GYNVIQVQTLNNVPSMNIYGQYSMTDGYNFKNINQKGVYGYWDHMDYIIRTAAKKGLYIG 124

QUERY       143 MVCIWGTPVEQGLMNEKEAVAYGKFLAERYKDEPNIIWMIGGDIRGDNKTEVWDALANSI 202
JCSG3297293 138 MVCIWGTPVEQGLMNEKEAVAYGKFLAERYKDEPNIIWMIGGDIRGDNKTEVWDALANSI 197
JCSG3191665 125 MVCIWGSPVSHGeMNvdQAkAYGKFLAERYKDEPNIIWFIGGDIRGDvKTaeWEALATSI 184

QUERY       203 RSIDKGHLMTFHPRGRTTSATWFNDREWLDFNMFQSGHRRYGQRNGDGDYPIEENTEEDN 262
JCSG3297293 198 RSIDKGHLMTFHPRGRTTSATWFNDREWLDFNMFQSGHRRYGQRNGDGDYPIEENTEEDN 257
JCSG3191665 185 KAIDKNHLMTFHPRGRTTSATWFNNapWLDFNMFQSGHRRYGQRfGDGDYPIEENTEEDN 244

QUERY       263 WRFVEASQAKTPLKPVIDDEPIYEDIPQGLHDPNETRWNQHDVRRYAYWSVFAGSFGHSY 322
JCSG3297293 258 WRFVEASQAKTPLKPVIDDEPIYEDIPQGLHDPNETRWNQHDVRRYAYWSVFAGSFGHSY 317
JCSG3191665 245 WRFVErSMAmkPMKPVIDgEPIYEEIPHGLHDeNEllWKDYDVRRYAYWSVFAGSFGHTY 304

QUERY       323 GHNDIMQFIRPGYGASFGADGRKKAWWDALEDPGFNQMKYLKNLMLTFPFFERVPDQSVI 382
JCSG3297293 318 GHNDIMQFIRPGYGASFGADGRKKAWWDALEDPGFNQMKYLKNLMLTFPFFERVPDQSVI 377
JCSG3191665 305 GHNSIMQFIKPGvGGAYGA---KKpWYDALNDPGYNQMKYLKNLMLTFPFFERVPDQSVI 361

QUERY       383 AGTNGERYDRAIATRGNDYLLVYNYSGRPMQIDLSKISGAKKNAWWYSAKDGKLEYIGEF 442
JCSG3297293 378 AGTNGERYDRAIATRGNDYLLVYNYSGRPMQIDLSKISGAKKNAWWYSAKDGKLEYIGEF 437
JCSG3191665 362 AGqNGERYDRAIATRGNDYLMVYNYTGRPMEVDFSKISGAKKNAWWYTTKDGKLEYIGEF 421

QUERY       443 DSKVTSFQHDSGYLSGNDQVLIVVDSAKDYVQKAWTALPDAIQKWNK 489
JCSG3297293 438 DSKVTSFQHDSGYLSGNDQVLIVVDSAKDYVQKAWTALPDAIQKWNK 484
JCSG3191665 422 DNgVhKFQHDSGYsSGNDHVLIVVDSSKDYVKK-------------- 454

Note
Homologous search is done using BLAST from NCBI BLAST against database pdbnr with expect (E-value cut-off) at 0.001. The structure of a PDB sequence may be fully or partly solved. The non-redundant database pdbnr consists of unique PDB sequences from the representative PDB chains. Each representative chain has the best structural coverage in the set of the same sequences. You could click a sequence ID to see all of PDB chains associated with the sequence ID plus sequence alignments and structural coverages.



Contact Webmaster JCSG Menu